Sequence:
download
CE49310sequence.fasta
>LIP-1, isoform b MTTHLPSTSQNGEEISAEQFNRIFHERNVIVLDCRSNGDSVKRANRFFCSLRLPALLQRRLMGGSMRLSTVPDLKDLNNS PDQCPEVLLIPGDSEQDEQLSAALARNLKSNHYRHFVLGEPVKTLLSQFPTLRDAADENWNTTFQMNSMPGQASGQQASS GPLLNLNQLRLEGEDQGGKQRAEFPVKLTNFLYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEEDPNMRYLRISADD NASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTD YEKMLGLNSNRVGTYPSSAPRSPSCAIEAAAVSQVGGLLTPPPTSCSASPQSSNHSAKSFH
view sequence (381 aa)
>LIP-1, isoform b
MTTHLPSTSQNGEEISAEQFNRIFHERNVIVLDCRSNGDSVKRANRFFCSLRLPALLQRRLMGGSMRLSTVPDLKDLNNS
PDQCPEVLLIPGDSEQDEQLSAALARNLKSNHYRHFVLGEPVKTLLSQFPTLRDAADENWNTTFQMNSMPGQASGQQASS
GPLLNLNQLRLEGEDQGGKQRAEFPVKLTNFLYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEEDPNMRYLRISADD
NASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTD
YEKMLGLNSNRVGTYPSSAPRSPSCAIEAAAVSQVGGLLTPPPTSCSASPQSSNHSAKSFH
Estimated Isoelectric Point:
6.55774688720703
Estimated Molecular Weight:
42.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr20
Lys14
Gln18
Leu41
Gly19
Met10
Ser41
Tyr8
His10
Glu20
Arg23
Cys9
Phe16
Pro22
Val17
Asn29
Ala30
Ile13
Trp2
Asp19