Sequence:
download
CE49289sequence.fasta
>GPA-16, isoform b MVLVEDCQTNRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMN KRTTGEKNQEIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
view sequence (126 aa)
>GPA-16, isoform b
MVLVEDCQTNRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMN
KRTTGEKNQEIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
Estimated Isoelectric Point:
4.87642669677734
Estimated Molecular Weight:
14.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys7
Gln6
Leu9
Gly3
Met3
Ser5
Tyr5
His1
Glu11
Arg7
Cys5
Phe9
Pro2
Val6
Asn11
Ala5
Ile10
Trp1
Asp8