Sequence:
download
CE49147sequence.fasta
>GPA-16, isoform c MRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMNKRTTGEKNQEI YTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
view sequence (115 aa)
>GPA-16, isoform c
MRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMNKRTTGEKNQEI
YTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
Estimated Isoelectric Point:
4.97148895263672
Estimated Molecular Weight:
13.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys7
Gln5
Leu8
Gly3
Met2
Ser5
Tyr5
His1
Glu10
Arg6
Cys4
Phe9
Pro2
Val4
Asn10
Ala5
Ile10
Trp1
Asp7