Sequence:
download
CE48983sequence.fasta
>MOG-4, isoform b MSEIESGWLLEVAPHYYKGRELEDATNKKMPKNKGKSGKDLER
view sequence (43 aa)
>MOG-4, isoform b
MSEIESGWLLEVAPHYYKGRELEDATNKKMPKNKGKSGKDLER
Estimated Isoelectric Point:
8.03089141845703
Estimated Molecular Weight:
4.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr1
Lys7
Leu4
Gly4
Met2
Ser3
Tyr2
His1
Glu6
Arg2
Pro2
Val1
Asn2
Ala2
Ile1
Trp1
Asp2