Sequence:
download
CE48959sequence.fasta
>RNP-3, isoform b MVFTQFGEIIQLMSFRKEKMRGQAHIVFKEVSSASNALRALQGFPFYGKPMRIQYAREDSDVISRAKGTFVEKRQKSTKI AKKPYEKPAKNGKSAAEPTQKEPQETDGPGLPNNILFCSNIPEGTEPEQIQTIFSQFPGLREVRWMPNTKDFAFIEYESE DLSEPARQALDNFRITPTQQITVKFASK
view sequence (188 aa)
>RNP-3, isoform b
MVFTQFGEIIQLMSFRKEKMRGQAHIVFKEVSSASNALRALQGFPFYGKPMRIQYAREDSDVISRAKGTFVEKRQKSTKI
AKKPYEKPAKNGKSAAEPTQKEPQETDGPGLPNNILFCSNIPEGTEPEQIQTIFSQFPGLREVRWMPNTKDFAFIEYESE
DLSEPARQALDNFRITPTQQITVKFASK
Estimated Isoelectric Point:
9.27545928955078
Estimated Molecular Weight:
21.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys17
Gln14
Leu8
Gly10
Met5
Ser13
Tyr4
His1
Glu17
Arg11
Cys1
Phe14
Pro14
Val7
Asn7
Ala14
Ile13
Trp1
Asp6