Sequence:
download
CE48884sequence.fasta
>LIR-1, isoform m MLLQLNDEERQRLMKMISTPGPQTLSMERIQMAPGQGQHILQQHQIPSTSSYTNNSFIYIKSDPQYKDEPQQQSNQFDAT VNSVAHGQAGLSTLEMFACNGSPNGGDVLRRKTPSRKAEDSIKATCKVCGHDVMYSPQRTWNLMRHVWIMHQSSKPNQCS ICGYSHIKPYVRKHIESQHKHDSNATIIDLKSPELEAEWSQLLDQCFGVTYRKWKHHKEDTQHTAGDEDYGHEHHFSPEE DVMTTL
view sequence (246 aa)
>LIR-1, isoform m
MLLQLNDEERQRLMKMISTPGPQTLSMERIQMAPGQGQHILQQHQIPSTSSYTNNSFIYIKSDPQYKDEPQQQSNQFDAT
VNSVAHGQAGLSTLEMFACNGSPNGGDVLRRKTPSRKAEDSIKATCKVCGHDVMYSPQRTWNLMRHVWIMHQSSKPNQCS
ICGYSHIKPYVRKHIESQHKHDSNATIIDLKSPELEAEWSQLLDQCFGVTYRKWKHHKEDTQHTAGDEDYGHEHHFSPEE
DVMTTL
Estimated Isoelectric Point:
6.45146942138672
Estimated Molecular Weight:
28.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys15
Gln22
Leu15
Gly13
Met10
Ser23
Tyr8
His16
Glu15
Arg10
Cys6
Phe5
Pro13
Val9
Asn10
Ala10
Ile13
Trp4
Asp14