Sequence:
download
CE48832sequence.fasta
>NHX-2 MSLLRRPWVLVVGLLLIMSYVGAECEEEEKEYPSRYPIAYFEWENVKIPMTICLWLIGASIAKIIFNLIPHLNELFPDSA LLIMIGLIIGIIFKLIGVNKNAFFLESEVFMLYLLPPLVFDAGYFMPARQFFDNFGSILCFAMIGTSFNIVAIALSLWAI SLTGLFSVETPLMHMLLFGSVAADVDPVAVIVIFEELKVNEVLFIAVFGESLLNDGVAVVLYRMFLTFSEIGTENLITSD YINGGVSFLVVAFGGIGIGLLFAFLTSLVTRFARDEEVKVLNSVFILILPYTCYLCGELFGLSSIMAIVFCGAAMRQYCR ENVDPDTVKATESFIKVLSLASETVIFVFLGLSTVSSNHHWDTSFIVLTVVFCLIYRTLGVVVMCYFLNKYRLNKYTKVD QFIMAYGGLRGAIAYGLVVAIPDFIPGKNMFVTSCIIVIYFTVFLQGITLKPIAEFLQVEKKNVHSKNMIEHIYSELIDT TMAGMEDIAGFKGHHWIRDSWNALNNNYLRPILVNKNNMKEMDKTKLVRKYKHLVDEDAKKIARGDLNSNMVFTKALIEH TRSRTNTMIDGVSSTSKIDFTKHMKENFGVTVYDDHSTVPMTPTHLFQETTEVEYSVRSEINDNDGFENDGYESDESGSF HERV
view sequence (644 aa)
>NHX-2
MSLLRRPWVLVVGLLLIMSYVGAECEEEEKEYPSRYPIAYFEWENVKIPMTICLWLIGASIAKIIFNLIPHLNELFPDSA
LLIMIGLIIGIIFKLIGVNKNAFFLESEVFMLYLLPPLVFDAGYFMPARQFFDNFGSILCFAMIGTSFNIVAIALSLWAI
SLTGLFSVETPLMHMLLFGSVAADVDPVAVIVIFEELKVNEVLFIAVFGESLLNDGVAVVLYRMFLTFSEIGTENLITSD
YINGGVSFLVVAFGGIGIGLLFAFLTSLVTRFARDEEVKVLNSVFILILPYTCYLCGELFGLSSIMAIVFCGAAMRQYCR
ENVDPDTVKATESFIKVLSLASETVIFVFLGLSTVSSNHHWDTSFIVLTVVFCLIYRTLGVVVMCYFLNKYRLNKYTKVD
QFIMAYGGLRGAIAYGLVVAIPDFIPGKNMFVTSCIIVIYFTVFLQGITLKPIAEFLQVEKKNVHSKNMIEHIYSELIDT
TMAGMEDIAGFKGHHWIRDSWNALNNNYLRPILVNKNNMKEMDKTKLVRKYKHLVDEDAKKIARGDLNSNMVFTKALIEH
TRSRTNTMIDGVSSTSKIDFTKHMKENFGVTVYDDHSTVPMTPTHLFQETTEVEYSVRSEINDNDGFENDGYESDESGSF
HERV
Estimated Isoelectric Point:
5.25379180908203
Estimated Molecular Weight:
72.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr36
Lys30
Gln6
Leu69
Gly40
Met24
Ser42
Tyr24
His14
Glu41
Arg20
Cys10
Phe48
Pro19
Val60
Asn33
Ala36
Ile57
Trp7
Asp28