Sequence:
download
CE48460sequence.fasta
>R09E10.5 MRRGCRHHLAAVVLLIATFPPLAYNQNIGGINQNIGGTPQNPTINQVSPGQIFSGTGNNPFYGVNLVPFGPEAGDLMVNP SMLTSGMTIDLYMFFPYYGGLYNYTTISVNGYLGFATVLDQGPTINVGPETTDWPRQEDPAMIAPYLCKQQVPQQGNPAR RAGVYYRLLLRQSLFGRESNSNLNLGGTLQQNAFFGQQASQACPGTADSYVRCDSNSDYFLDQMMIWVQEGVAGGAMFRA DAAVVVTWYNTASAISGRSDIDAGQTGTYQVIWLTDSTARLSYVIINYDRLGFDAQDFRGNSRSGRCRAVFNGGNHTGTV EVDPTQPYKNTPKVLAQRSGVPHMVRGRYMFRVDDVVRPAGCSNKTGGTYPIMIYPNIVNMLGDMTVDVNACCLDRTQTY IMMIEEREVATCQVINPAIARCSLPRIYDWGTKTVYFQPESRGANDEKAFVGYIYFVPPTLDPMRLDIGNIYEWYKNPMT NYLMPITWYPRNFTNPDILTNGNNMGVRISDDSMYGVQLGLYIVGYREFKDDEIKKFRPEYRTLARITTYSNQNNANYRW MPQEEVINTNQVQQWYLTDWERMHTLYTYRVGFFKLAPINPNDANGTQLLPGLVSAPISLHWLWTPENQQFATLTLNQQD RDQRIEFVKEKSREMCHDWYDEDGALWNFIRDTETNTSCPCIETQALLDLGRFMPHPRCSQMFRDITCTTVIGSKNCYMS SSNIYSSYAGNGNTFNNMDTNRFMTHYGQVCCYDESGYLMQTPYQPVIKTQREYFYNPGYPLRAYEFGTAPYMGQFEVPG LSVFHNDYMPYFLCCKFADFRCQMFYWRRPSSACQQYQPPAIGHAQGAGVFQTIDNDKFIFNQPGVFNFLYIPQSVRTPE VRIQTRLERYPNRKVDFGLLGRYISQYELVQPTNATVITGIALEATGTERVIVMTRKDTRRFRYRTNIIVGNILRYFDTI RLQRFRGVLIYVNNVERGQPEIYVVLEEAQIGVKVTESYALDIDRLPNYQESMGMLDIQISVSPQYGVRPDGDKTQETQY RQMYNLPRVSGLIRPYPDQTSGSLNEGLTLNDVNSDSYRQQIINNYLVLGTGEPGTQQNQAGTLNQNMPQDNMFTTSRDE DKQFDVFPEASMRSEPVYKTAPIFDTGSYRFVPQTGAMILQLLNTCRDLQNNPNTDLQPYQSIATLSYGLQCPDDPGQVL TECGDSVACLYDYALLNSKVLGQEEQDAWNMFTTDRALAIRQYNSCGAINIEYPEYMMKTPALSSGYLQGDVARFECYQS HWVKGDHEYKCGIVVDYNRPNEYRFEWNKGNQPWCRSRIKENYFKWLAVIAGIVGIIIVILLIFLVFWCIKRKKLQESRN YSGTAAYSNNAFQNQTYETKPSRALSVGDLSTAPRTVAMPPPRGTTATPMTLEPRGFSPVPSDVRGSQGMLGLNTSV
view sequence (1437 aa)
>R09E10.5
MRRGCRHHLAAVVLLIATFPPLAYNQNIGGINQNIGGTPQNPTINQVSPGQIFSGTGNNPFYGVNLVPFGPEAGDLMVNP
SMLTSGMTIDLYMFFPYYGGLYNYTTISVNGYLGFATVLDQGPTINVGPETTDWPRQEDPAMIAPYLCKQQVPQQGNPAR
RAGVYYRLLLRQSLFGRESNSNLNLGGTLQQNAFFGQQASQACPGTADSYVRCDSNSDYFLDQMMIWVQEGVAGGAMFRA
DAAVVVTWYNTASAISGRSDIDAGQTGTYQVIWLTDSTARLSYVIINYDRLGFDAQDFRGNSRSGRCRAVFNGGNHTGTV
EVDPTQPYKNTPKVLAQRSGVPHMVRGRYMFRVDDVVRPAGCSNKTGGTYPIMIYPNIVNMLGDMTVDVNACCLDRTQTY
IMMIEEREVATCQVINPAIARCSLPRIYDWGTKTVYFQPESRGANDEKAFVGYIYFVPPTLDPMRLDIGNIYEWYKNPMT
NYLMPITWYPRNFTNPDILTNGNNMGVRISDDSMYGVQLGLYIVGYREFKDDEIKKFRPEYRTLARITTYSNQNNANYRW
MPQEEVINTNQVQQWYLTDWERMHTLYTYRVGFFKLAPINPNDANGTQLLPGLVSAPISLHWLWTPENQQFATLTLNQQD
RDQRIEFVKEKSREMCHDWYDEDGALWNFIRDTETNTSCPCIETQALLDLGRFMPHPRCSQMFRDITCTTVIGSKNCYMS
SSNIYSSYAGNGNTFNNMDTNRFMTHYGQVCCYDESGYLMQTPYQPVIKTQREYFYNPGYPLRAYEFGTAPYMGQFEVPG
LSVFHNDYMPYFLCCKFADFRCQMFYWRRPSSACQQYQPPAIGHAQGAGVFQTIDNDKFIFNQPGVFNFLYIPQSVRTPE
VRIQTRLERYPNRKVDFGLLGRYISQYELVQPTNATVITGIALEATGTERVIVMTRKDTRRFRYRTNIIVGNILRYFDTI
RLQRFRGVLIYVNNVERGQPEIYVVLEEAQIGVKVTESYALDIDRLPNYQESMGMLDIQISVSPQYGVRPDGDKTQETQY
RQMYNLPRVSGLIRPYPDQTSGSLNEGLTLNDVNSDSYRQQIINNYLVLGTGEPGTQQNQAGTLNQNMPQDNMFTTSRDE
DKQFDVFPEASMRSEPVYKTAPIFDTGSYRFVPQTGAMILQLLNTCRDLQNNPNTDLQPYQSIATLSYGLQCPDDPGQVL
TECGDSVACLYDYALLNSKVLGQEEQDAWNMFTTDRALAIRQYNSCGAINIEYPEYMMKTPALSSGYLQGDVARFECYQS
HWVKGDHEYKCGIVVDYNRPNEYRFEWNKGNQPWCRSRIKENYFKWLAVIAGIVGIIIVILLIFLVFWCIKRKKLQESRN
YSGTAAYSNNAFQNQTYETKPSRALSVGDLSTAPRTVAMPPPRGTTATPMTLEPRGFSPVPSDVRGSQGMLGLNTSV
Estimated Isoelectric Point:
5.97626495361328
Estimated Molecular Weight:
163.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr103
Lys34
Gln92
Leu98
Gly109
Met47
Ser75
Tyr90
His13
Glu59
Arg92
Cys31
Phe61
Pro90
Val90
Asn99
Ala76
Ile81
Trp21
Asp76