Sequence:
download
CE48414sequence.fasta
>NRX-1, isoform m MVFLEHLRGGTPRGTTTVSPILCLMNWNDEQCRQQLKSYIPKFASNFDAPRHVPQPPSSPSYDYEGDEDEEKKEEKDHGI ADRSMNDVSGETTGFFSPVLPTVANFPTTRQTEHIDNEVTALITSSLAPQKTRPKSTPHFTVYPVRPTTPMGDTITTTMQ AATVTDFPRTPLIMCSSLAVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRSNDSCTQPLLA KPHINGNGYEPLKGAVIANGNGATATMMRNGNGNGVAKKKDFKEWYV
view sequence (287 aa)
>NRX-1, isoform m
MVFLEHLRGGTPRGTTTVSPILCLMNWNDEQCRQQLKSYIPKFASNFDAPRHVPQPPSSPSYDYEGDEDEEKKEEKDHGI
ADRSMNDVSGETTGFFSPVLPTVANFPTTRQTEHIDNEVTALITSSLAPQKTRPKSTPHFTVYPVRPTTPMGDTITTTMQ
AATVTDFPRTPLIMCSSLAVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRSNDSCTQPLLA
KPHINGNGYEPLKGAVIANGNGATATMMRNGNGNGVAKKKDFKEWYV
Estimated Isoelectric Point:
6.44762420654297
Estimated Molecular Weight:
31.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys15
Gln10
Leu14
Gly17
Met11
Ser20
Tyr8
His8
Glu15
Arg12
Cys5
Phe12
Pro27
Val17
Asn17
Ala21
Ile13
Trp2
Asp14