Sequence:
download
CE48323sequence.fasta
>IRLD-38 MNSFAQIFVLLIFFLLHFCIADRAENVQNVLSTFNCKNNCIFNYTEINSTTIKFFPRCPEVCAILFIDEKTDLTVAQLKK AFASMFTLVGGLVIENTNLTSISIFSTDAYMSFNIACDTYGVFIRNNRKLKDNSMLSGLYVFRAGDNQECDFQIKNNPLL KVDCEDRYLSEYSKIEVSGNLENCGCKGGEIEISTKNQFANCSVLYGGLQIFNKTPDLSALSNIEIIKGEIEIQNSNFQN LTFLKNLKTIKFRNDGKTENYLINIKNDPEMTRLGLPIGENTEMTNVWQVPMEITIINLENLNPEFCLSLSEILFYFHKS HFSVENLDAKLCPVDTNATKILNPFSENGDFYIICHFISMALLPSNCDIIIGNLIIEAGDEVYTTKLEYTKHLIGTLVIR NTNLVEIEFLGLLSFICSLDETLPLIQIYSNKNLKIANFPEVANIITRGKRIAIIQDNHEDLFKFEPCALFSPFYESTFQ KYQTNLTYVGGDCGLDTAEINYSRGSYLLKLFALILIISSLK
view sequence (522 aa)
>IRLD-38
MNSFAQIFVLLIFFLLHFCIADRAENVQNVLSTFNCKNNCIFNYTEINSTTIKFFPRCPEVCAILFIDEKTDLTVAQLKK
AFASMFTLVGGLVIENTNLTSISIFSTDAYMSFNIACDTYGVFIRNNRKLKDNSMLSGLYVFRAGDNQECDFQIKNNPLL
KVDCEDRYLSEYSKIEVSGNLENCGCKGGEIEISTKNQFANCSVLYGGLQIFNKTPDLSALSNIEIIKGEIEIQNSNFQN
LTFLKNLKTIKFRNDGKTENYLINIKNDPEMTRLGLPIGENTEMTNVWQVPMEITIINLENLNPEFCLSLSEILFYFHKS
HFSVENLDAKLCPVDTNATKILNPFSENGDFYIICHFISMALLPSNCDIIIGNLIIEAGDEVYTTKLEYTKHLIGTLVIR
NTNLVEIEFLGLLSFICSLDETLPLIQIYSNKNLKIANFPEVANIITRGKRIAIIQDNHEDLFKFEPCALFSPFYESTFQ
KYQTNLTYVGGDCGLDTAEINYSRGSYLLKLFALILIISSLK
Estimated Isoelectric Point:
4.98484039306641
Estimated Molecular Weight:
59.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr33
Lys31
Gln14
Leu60
Gly25
Met8
Ser34
Tyr18
His6
Glu36
Arg12
Cys18
Phe38
Pro15
Val21
Asn51
Ala22
Ile56
Trp1
Asp23