Sequence:
download
CE48309sequence.fasta
>IFB-2, isoform e MSAVSYSMHRTTTTTSSSSHGGVSAGHAAEEFVASAEREKQEMQQLNSRLEVYISRVRQLEDRNKELVIELDTLRGSLGN DIGQIKFKFNDSLVKVRREISEAHSGTIGVEVKVDRLRDDLNDYRHRYEEARREVEREKTTWGGAISQAQAELDTNKSRY AAILDEEKRLYAEQDQLYLQLAAAKDELDAAIVDRRRLQAEEDDLKIELEFLGRIHSQEITELRTLLAQAPADTREFFKN ELALAIREIKAEYDKIIQTTRVDLETIFQSKISAVESSIVSKNEAAVFRQEEIRKMNESITTLRAKLSELEARNSALERE ANTLQIQLGEDQRAYESELHKRDNALRFMREDCQTLIAELQALLNTKQTLDTEIAIYRKLVESEEGRFTHVGQGVVVAQQ ETTRTEGDSTPVVLNDQQYSDSHQYQQYPEVYPQGTLRLVPVEQDHWDSGEVQTRSSFKRHAKGNVSIVECDPQGKYIIL ENTSGSVAEDVSNFEIRRVIDGVQAFVFRLPSHLVIQQHGHLKIYGRNSGGINSPPDSIVMESHPSWGQGGQVETFLYNS HGIEKASHIQTTVASSR
view sequence (577 aa)
>IFB-2, isoform e
MSAVSYSMHRTTTTTSSSSHGGVSAGHAAEEFVASAEREKQEMQQLNSRLEVYISRVRQLEDRNKELVIELDTLRGSLGN
DIGQIKFKFNDSLVKVRREISEAHSGTIGVEVKVDRLRDDLNDYRHRYEEARREVEREKTTWGGAISQAQAELDTNKSRY
AAILDEEKRLYAEQDQLYLQLAAAKDELDAAIVDRRRLQAEEDDLKIELEFLGRIHSQEITELRTLLAQAPADTREFFKN
ELALAIREIKAEYDKIIQTTRVDLETIFQSKISAVESSIVSKNEAAVFRQEEIRKMNESITTLRAKLSELEARNSALERE
ANTLQIQLGEDQRAYESELHKRDNALRFMREDCQTLIAELQALLNTKQTLDTEIAIYRKLVESEEGRFTHVGQGVVVAQQ
ETTRTEGDSTPVVLNDQQYSDSHQYQQYPEVYPQGTLRLVPVEQDHWDSGEVQTRSSFKRHAKGNVSIVECDPQGKYIIL
ENTSGSVAEDVSNFEIRRVIDGVQAFVFRLPSHLVIQQHGHLKIYGRNSGGINSPPDSIVMESHPSWGQGGQVETFLYNS
HGIEKASHIQTTVASSR
Estimated Isoelectric Point:
5.32257843017578
Estimated Molecular Weight:
65.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr34
Lys26
Gln40
Leu49
Gly30
Met6
Ser48
Tyr17
His17
Glu63
Arg46
Cys2
Phe15
Pro10
Val39
Asn20
Ala44
Ile36
Trp3
Asp32