Sequence:
download
CE48050sequence.fasta
>UNC-104, isoform a MSSVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWSFARNDPHFITQKQVYEELGVEMLEH AFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNPNSG GNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSK ISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAM LAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTDVQETPGKHKKGPKLP AHVHEQLEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECL IYYLKEGVTSVGRPEAEHRPDILLSGEAILELHCEFINEDGNVTLTMKPNASCYINGKQVTTPTVLHTGSRVILGEHHVF RYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGIDLKADMEKKMLEMESQYRREKVELEQKMYHQTREYESMIENL QKQVDLAQSYISGGGSIWEGERMLTSSLLEFPEELKWTSDQKRVVLKAAIKWRYHQFTSVRDDLWGNAIFVKEANAISVE LKKKVQFQFALLTDTMYSPLPPDLLPPGEDLTLRPYPKTVVAIQVQDLKNGATHYWSIEKLKQRLEAMRDMYETDAEMSP ADGDPMMDALMGTDPFYDRFPWFRMVGRAFVYLNNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPVQKDEVINQKKGVRQ TAKLHFRKEDFLKSHKNGETSDSDALAFPEHMQEEVEFCFRVVVLQAIDVADTYSDVFCQFNFLHRHDEAFSTEPMKNSK SPLTFEHTQNLHIKMSKTFLHYLHHFPIIFEVFGHFQPKSEQFNFERQNSALGRRLSTKLTFQQPSLVISTPVKSKKANA PIQNNNASVKSKHDLLVWFEICELANNGEYVPTIVDHAQGLPTHGIFLLHQGIQRRIKITICHEKGELKWKDCQELVVGR IRAGPEWAGGDDVDVLSLGLFPGTFMEFSMDDRTFFQFEAAWDSSLHNSPLLNRVSNYGDQIYMTLSAYMELDGCAQPAV VTKDLCLLIYARDSKISAASRFCRSLVGGISKSPEMNRVPGVYQLCLKDGSDSGSPGAIRRQRRVLDTSSAYVRGEENLG QWRPRGDSLIFEHQWELEKLTRLQQVERVRLFLRLRDRLKGKKNKGEARTPVSPCDPVCAIPESIKLDEKDKGIVGKVLG LIRRKIPMNKDPPTGNKAQELSDESGSNSITSPVSDKSLIKSSRSSDLLCRQKSKSDQNLASNDDIVDNLGGMKRSLSGS RILQLNILVPEVLEERVGVVVSKKGYMNFLEEKTQGWTRRWVIVRRPYILLFRDDRDLVIRGIINLANARIEHSEDQQAM VKVPNTFSVCTNQRGFLMQMMPGDEMYDWLYAINPLMAGQMKLHGNQNGTTLKSPTSSSSIAAS
view sequence (1584 aa)
>UNC-104, isoform a
MSSVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWSFARNDPHFITQKQVYEELGVEMLEH
AFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNPNSG
GNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSK
ISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAM
LAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTDVQETPGKHKKGPKLP
AHVHEQLEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECL
IYYLKEGVTSVGRPEAEHRPDILLSGEAILELHCEFINEDGNVTLTMKPNASCYINGKQVTTPTVLHTGSRVILGEHHVF
RYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGIDLKADMEKKMLEMESQYRREKVELEQKMYHQTREYESMIENL
QKQVDLAQSYISGGGSIWEGERMLTSSLLEFPEELKWTSDQKRVVLKAAIKWRYHQFTSVRDDLWGNAIFVKEANAISVE
LKKKVQFQFALLTDTMYSPLPPDLLPPGEDLTLRPYPKTVVAIQVQDLKNGATHYWSIEKLKQRLEAMRDMYETDAEMSP
ADGDPMMDALMGTDPFYDRFPWFRMVGRAFVYLNNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPVQKDEVINQKKGVRQ
TAKLHFRKEDFLKSHKNGETSDSDALAFPEHMQEEVEFCFRVVVLQAIDVADTYSDVFCQFNFLHRHDEAFSTEPMKNSK
SPLTFEHTQNLHIKMSKTFLHYLHHFPIIFEVFGHFQPKSEQFNFERQNSALGRRLSTKLTFQQPSLVISTPVKSKKANA
PIQNNNASVKSKHDLLVWFEICELANNGEYVPTIVDHAQGLPTHGIFLLHQGIQRRIKITICHEKGELKWKDCQELVVGR
IRAGPEWAGGDDVDVLSLGLFPGTFMEFSMDDRTFFQFEAAWDSSLHNSPLLNRVSNYGDQIYMTLSAYMELDGCAQPAV
VTKDLCLLIYARDSKISAASRFCRSLVGGISKSPEMNRVPGVYQLCLKDGSDSGSPGAIRRQRRVLDTSSAYVRGEENLG
QWRPRGDSLIFEHQWELEKLTRLQQVERVRLFLRLRDRLKGKKNKGEARTPVSPCDPVCAIPESIKLDEKDKGIVGKVLG
LIRRKIPMNKDPPTGNKAQELSDESGSNSITSPVSDKSLIKSSRSSDLLCRQKSKSDQNLASNDDIVDNLGGMKRSLSGS
RILQLNILVPEVLEERVGVVVSKKGYMNFLEEKTQGWTRRWVIVRRPYILLFRDDRDLVIRGIINLANARIEHSEDQQAM
VKVPNTFSVCTNQRGFLMQMMPGDEMYDWLYAINPLMAGQMKLHGNQNGTTLKSPTSSSSIAAS
Estimated Isoelectric Point:
6.74146270751953
Estimated Molecular Weight:
179.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr75
Lys114
Gln72
Leu154
Gly93
Met46
Ser115
Tyr42
His46
Glu118
Arg89
Cys25
Phe56
Pro68
Val106
Asn83
Ala89
Ile82
Trp19
Asp92