Sequence:
download
CE47959sequence.fasta
>MET-2 MDQQEPSNNVDTSSILSDDGMETQEQSSFVTATIDLTVDDYDETEIQEILDNGKAEEGTDEDSDLVEGILNANSDVQALL DAPSEQVAQALNSFFGNESEQEAVAAQRRVDAEKTAKDEAELKQQEEAEDLIIEDSIVKTDEEKQAVRRLKINEFLSWFT RLLPEQFKNFEFTNPNYLTESISDSPVVNVDKCKEIVKSFKESESLEGLSQKYELIDEDVLVAAICIGVLDTNNEEDVDF NVLCDDRIDDWSIEKCVTFLDYPNTGLNSKNGPLRFMQFTVTSPASAILMLTLIRLREEGHPCRLDFDSNPTDDLLLNFD QVEFSNNIIDTAVKYWDDQKENGAQDKIGRELNDFFHEIESTSAEFKQHFENAVGSRNEIIQLVNEKIPDFDGTEAAVNE SFTSDQRTEIINSRAIMETLKAEMKLAIAEAQKVYDTKTDFEKFFVLTVGDFCLARANPSDDAELTYAIVQDRVDAMTYK VKFIDTSQIRECNIRDLAMTTQGMYDPSLNTFGDVGLRVACRQVISSSQFGKKTIWLTGTAAGRRRAHRSDFLIFFDNGT DAYVSAPTMPGEPGYEVASEKKSVFSLKEMIAKMNAAQIAIMVGQPVGKEGNLDYFLTFHWIRQSHRSAYIRDFMKEFPE WPLLKMPVGMRICLYNSLVDRRKKMVTVIGTDRAFAIVRHEAPNPLAPGNRCTDFPCNDRNHQHIDEKIYRGSHRLEGAA HKKHMISTNNNLSQRRKDQLQSQFEPTDMIRSMPERNHQQVVKKKTTGTNQNVASTNDAKSKREIEIRKKNQFLFNKIIV PIPVLTPLENLKAHAQCGPDCLQKMDADPYEARFHRNSPIHTPLLCGWRRIMYTMSTGKKRGAVKKNIIYFSPCGAALHQ ISDVSEYIHVTRSLLTIDCFSFDARIDTATYITVDDKYLKVADFSLGTEGIPIPLVNSVDNDEPPSLEYSKRRFQYNDQV DISSVSRDFCSGCSCDGDCSDASKCECQQLSIEAMKRLPHNLQFDGHDELVPHYQNRLLSSKVISGLYECNDQCSCHRKS CYNRVVQNNIKYPMHIFKTAQSGWGVRALTDIPQSTFICTYVGAILTDDLADELRNADQYFADLDLKDTVELEKGREDHE TDFGYGGDESDYDDEEGSDGDSGDDVMNKMVKRQDSSESGEETKRLTRQKRKQSKKSGKGGSVEKDDTTPRDSMEKDNIE SKDEPVFNWDKYFEPFPLYVIDAKQRGNLGRFLNHSCDPNVHVQHVMYDTHDLRLPWVAFFTRKYVKAGDELTWDYQYTQ DQTATTQLTCHCGAENCTGRLLKS
view sequence (1304 aa)
>MET-2
MDQQEPSNNVDTSSILSDDGMETQEQSSFVTATIDLTVDDYDETEIQEILDNGKAEEGTDEDSDLVEGILNANSDVQALL
DAPSEQVAQALNSFFGNESEQEAVAAQRRVDAEKTAKDEAELKQQEEAEDLIIEDSIVKTDEEKQAVRRLKINEFLSWFT
RLLPEQFKNFEFTNPNYLTESISDSPVVNVDKCKEIVKSFKESESLEGLSQKYELIDEDVLVAAICIGVLDTNNEEDVDF
NVLCDDRIDDWSIEKCVTFLDYPNTGLNSKNGPLRFMQFTVTSPASAILMLTLIRLREEGHPCRLDFDSNPTDDLLLNFD
QVEFSNNIIDTAVKYWDDQKENGAQDKIGRELNDFFHEIESTSAEFKQHFENAVGSRNEIIQLVNEKIPDFDGTEAAVNE
SFTSDQRTEIINSRAIMETLKAEMKLAIAEAQKVYDTKTDFEKFFVLTVGDFCLARANPSDDAELTYAIVQDRVDAMTYK
VKFIDTSQIRECNIRDLAMTTQGMYDPSLNTFGDVGLRVACRQVISSSQFGKKTIWLTGTAAGRRRAHRSDFLIFFDNGT
DAYVSAPTMPGEPGYEVASEKKSVFSLKEMIAKMNAAQIAIMVGQPVGKEGNLDYFLTFHWIRQSHRSAYIRDFMKEFPE
WPLLKMPVGMRICLYNSLVDRRKKMVTVIGTDRAFAIVRHEAPNPLAPGNRCTDFPCNDRNHQHIDEKIYRGSHRLEGAA
HKKHMISTNNNLSQRRKDQLQSQFEPTDMIRSMPERNHQQVVKKKTTGTNQNVASTNDAKSKREIEIRKKNQFLFNKIIV
PIPVLTPLENLKAHAQCGPDCLQKMDADPYEARFHRNSPIHTPLLCGWRRIMYTMSTGKKRGAVKKNIIYFSPCGAALHQ
ISDVSEYIHVTRSLLTIDCFSFDARIDTATYITVDDKYLKVADFSLGTEGIPIPLVNSVDNDEPPSLEYSKRRFQYNDQV
DISSVSRDFCSGCSCDGDCSDASKCECQQLSIEAMKRLPHNLQFDGHDELVPHYQNRLLSSKVISGLYECNDQCSCHRKS
CYNRVVQNNIKYPMHIFKTAQSGWGVRALTDIPQSTFICTYVGAILTDDLADELRNADQYFADLDLKDTVELEKGREDHE
TDFGYGGDESDYDDEEGSDGDSGDDVMNKMVKRQDSSESGEETKRLTRQKRKQSKKSGKGGSVEKDDTTPRDSMEKDNIE
SKDEPVFNWDKYFEPFPLYVIDAKQRGNLGRFLNHSCDPNVHVQHVMYDTHDLRLPWVAFFTRKYVKAGDELTWDYQYTQ
DQTATTQLTCHCGAENCTGRLLKS
Estimated Isoelectric Point:
4.90569305419922
Estimated Molecular Weight:
148.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr79
Lys83
Gln63
Leu93
Gly63
Met29
Ser92
Tyr37
His29
Glu98
Arg69
Cys31
Phe60
Pro48
Val76
Asn69
Ala79
Ile74
Trp11
Asp121