Sequence:
download
CE47855sequence.fasta
>UNC-104, isoform b MSSVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWSFARNDPHFITQKQVYEELGVEMLEH AFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNPNSG GNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSK ISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAM LAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTDVQETPGKHKKGPKLP AHVHEQLEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECL IYYLKEGVTSVGRPEAEHRPDILLSGEAILELHCEFINEDGNVTLTMKPNASCYINGKQVTTPTVLHTGSRVILGEHHVF RYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGIDLKADMEKKMLEMESQYRREKVELEQKMYHQTREYESMIENL QKQVDLAQSYISGGGSIWEGERMLTSSLLEFPEELKWTSDQKRVVLKAAIKWRYHQFTSVRDDLWGNAIFVKEANAISVE LKKKVQFQFALLTDTMYSPLPPDLLPPGEDLTLRPYPKTVVAIQVQDLKNGATHYWSIEKLKQRLEDMRIFYNSELSVAG TPVDVPYPPVAEGWLAALNRNSARLIPDRQRLEAMRDMYETDAEMSPADGDPMMDALMGTDPFYDRFPWFRMVGRAFVYL NNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPVQKDEVINQKKGVRQTAKLHFRKEDFLKSHKNGETSDSDALAFPEHMQ EEVEFCFRVVVLQAIDVADTYSDVFCQFNFLHRHDEAFSTEPMKNSKSPLTFEHTQNLHIKMSKTFLHYLHHFPIIFEVF GHFQPKSEQFNFERQNSALGRRLSTKLTFQQPSLVISTPVKSKKANAPIQNNNASVKSKHDLLVWFEICELANNGEYVPT IVDHAQGLPTHGIFLLHQGIQRRIKITICHEKGELKWKDCQELVVGRIRAGPEWAGGDDVDVLSLGLFPGTFMEFSMDDR TFFQFEAAWDSSLHNSPLLNRVSNYGDQIYMTLSAYMELDGCAQPAVVTKDLCLLIYARDSKISAASRFCRSLVGGISKS PEMNRVPGVYQLCLKDGSDSGAIRRQRRVLDTSSAYVRGEENLGQWRPRGDSLIFEHQWELEKLTRLQQVERVRLFLRLR DRLKGKKNKGEARTPVSPCDPVCAIPESIKLDEKDKGIVGKVLGLIRRKIPMNKDPPTGNKAQELSDESGSNSITSPVSD KSLIKSSRSSDLLCRQKSKSDQNLASNDDIVDNLGGMKRSLSGSRILQLNILVPEVLEERVGVVVSKKGYMNFLEEKTQG WTRRWVIVRRPYILLFRDDRDLVIRGIINLANARIEHSEDQQAMVKVPNTFSVCTNQRGFLMQMMPGDEMYDWLYAINPL MAGQMKLHGNQNGTTLKSPTSSSSIAAS
view sequence (1628 aa)
>UNC-104, isoform b
MSSVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWSFARNDPHFITQKQVYEELGVEMLEH
AFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNPNSG
GNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSK
ISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAM
LAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTDVQETPGKHKKGPKLP
AHVHEQLEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECL
IYYLKEGVTSVGRPEAEHRPDILLSGEAILELHCEFINEDGNVTLTMKPNASCYINGKQVTTPTVLHTGSRVILGEHHVF
RYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGIDLKADMEKKMLEMESQYRREKVELEQKMYHQTREYESMIENL
QKQVDLAQSYISGGGSIWEGERMLTSSLLEFPEELKWTSDQKRVVLKAAIKWRYHQFTSVRDDLWGNAIFVKEANAISVE
LKKKVQFQFALLTDTMYSPLPPDLLPPGEDLTLRPYPKTVVAIQVQDLKNGATHYWSIEKLKQRLEDMRIFYNSELSVAG
TPVDVPYPPVAEGWLAALNRNSARLIPDRQRLEAMRDMYETDAEMSPADGDPMMDALMGTDPFYDRFPWFRMVGRAFVYL
NNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPVQKDEVINQKKGVRQTAKLHFRKEDFLKSHKNGETSDSDALAFPEHMQ
EEVEFCFRVVVLQAIDVADTYSDVFCQFNFLHRHDEAFSTEPMKNSKSPLTFEHTQNLHIKMSKTFLHYLHHFPIIFEVF
GHFQPKSEQFNFERQNSALGRRLSTKLTFQQPSLVISTPVKSKKANAPIQNNNASVKSKHDLLVWFEICELANNGEYVPT
IVDHAQGLPTHGIFLLHQGIQRRIKITICHEKGELKWKDCQELVVGRIRAGPEWAGGDDVDVLSLGLFPGTFMEFSMDDR
TFFQFEAAWDSSLHNSPLLNRVSNYGDQIYMTLSAYMELDGCAQPAVVTKDLCLLIYARDSKISAASRFCRSLVGGISKS
PEMNRVPGVYQLCLKDGSDSGAIRRQRRVLDTSSAYVRGEENLGQWRPRGDSLIFEHQWELEKLTRLQQVERVRLFLRLR
DRLKGKKNKGEARTPVSPCDPVCAIPESIKLDEKDKGIVGKVLGLIRRKIPMNKDPPTGNKAQELSDESGSNSITSPVSD
KSLIKSSRSSDLLCRQKSKSDQNLASNDDIVDNLGGMKRSLSGSRILQLNILVPEVLEERVGVVVSKKGYMNFLEEKTQG
WTRRWVIVRRPYILLFRDDRDLVIRGIINLANARIEHSEDQQAMVKVPNTFSVCTNQRGFLMQMMPGDEMYDWLYAINPL
MAGQMKLHGNQNGTTLKSPTSSSSIAAS
Estimated Isoelectric Point:
6.68357086181641
Estimated Molecular Weight:
184.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr76
Lys114
Gln73
Leu159
Gly94
Met47
Ser117
Tyr44
His46
Glu121
Arg94
Cys25
Phe57
Pro72
Val110
Asn86
Ala94
Ile84
Trp20
Asp95