Sequence:
download
CE47672sequence.fasta
>NHR-274, isoform a MSSGEVMTYGEIHRISTSSPDTSPPGTSTQDDTDGCAVCGDRVNGKRYGAPACLGCIVFFRRAVTNEVTYKCLKGGTCVI TNESRCICRYCRLQKCYTVGMKASAIQRRDVMGPRKPKIKESIVKTEIIEEVPKLIMSSNPSSTGSMSEGPPKHKRPLLE DLVEVQRWQCSKHHSFFEAHEAINLDGDLYAHMHLKLNGTLHRRARARDVNSMLKLGLIDAATWGNQFDLFRRLSTEEKK HILTEFGFTFMLVDQGYKTAQKAEKGFWLLQNDTYMHEDYFLGLPEEDARKENAATKAKLHPLFVNESLNCVGYPFKNLQ IDEHECAVLKTILLLTQQGVFKHCVNEVKHLYDCCMTELMGHSQRKYPDTAAERFGTIILLTSSIRCAINALYNQTRVSD VFDLMKFDPLVRDVLLS
view sequence (417 aa)
>NHR-274, isoform a
MSSGEVMTYGEIHRISTSSPDTSPPGTSTQDDTDGCAVCGDRVNGKRYGAPACLGCIVFFRRAVTNEVTYKCLKGGTCVI
TNESRCICRYCRLQKCYTVGMKASAIQRRDVMGPRKPKIKESIVKTEIIEEVPKLIMSSNPSSTGSMSEGPPKHKRPLLE
DLVEVQRWQCSKHHSFFEAHEAINLDGDLYAHMHLKLNGTLHRRARARDVNSMLKLGLIDAATWGNQFDLFRRLSTEEKK
HILTEFGFTFMLVDQGYKTAQKAEKGFWLLQNDTYMHEDYFLGLPEEDARKENAATKAKLHPLFVNESLNCVGYPFKNLQ
IDEHECAVLKTILLLTQQGVFKHCVNEVKHLYDCCMTELMGHSQRKYPDTAAERFGTIILLTSSIRCAINALYNQTRVSD
VFDLMKFDPLVRDVLLS
Estimated Isoelectric Point:
8.22582244873047
Estimated Molecular Weight:
47.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr28
Lys29
Gln14
Leu40
Gly26
Met13
Ser26
Tyr13
His15
Glu27
Arg25
Cys17
Phe17
Pro16
Val25
Asn16
Ala24
Ile20
Trp3
Asp23