Sequence:
download
CE47540sequence.fasta
>NRX-1, isoform l MRQKFDDTGQYLTIWLVFTVSLFSVVDSIILTGAPDSYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGNFYSL TIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILKNS DVFIGGLPPNMHMLPVMSSPLRRYARHLAVNVRNLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSMSSREQFVCLNDG ECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS YLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMHSEEMVAIHMTLIVDGRRDEIRQYAPEL DWISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSF TETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGE WHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVYPSSVWSIALQKGYTGCIKNIRMNGVSTKI GQEFEASNSTGIELGCSLSNELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTK VSQVEHIKIRFRTTSSRGVLFDTGANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLY LDGFWSHSIYLQNPISVEIDEVGAAFSVHSSAPPPRDEHFKGFLSKLVFNGNDYLAKTKMNSAQLSKSSSRESKGQRNVK TRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLMRSALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTT SPKLPHRQHLSDMRWHNVLIYQDEKTHDHVLLVDNSSTTLIIDKIKKVESKMSGKLYFGSNPLGVSRPSNGFRGCISTLR INENALDLYEDADSRMKVNRGCSGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYE YAPNERPTTSKDYFVFSFRTTQPNGVLISIECAADQDYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISR TEANMTIQVDKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILDL YENGSNRIHTIGAPQTTAVSEQVSSESEEDDELAEMMMAHSIDENPNEALIESLAPSCLSLEEQQSCFIDTDDSTGFFSP VLPTVANFPTTRQTEHIDNEVTALITSSLAPQKTRPKSTPHFTVYPVRPTTPMGDTITTTMQAATVTDFPRTPLIMCSSL AVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRSNDSCTQPLLAKPHINGNGYEPLKGAVIA NGNGATATMMRNGNGNGVAKKKDFKEWYV
view sequence (1549 aa)
>NRX-1, isoform l
MRQKFDDTGQYLTIWLVFTVSLFSVVDSIILTGAPDSYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGNFYSL
TIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILKNS
DVFIGGLPPNMHMLPVMSSPLRRYARHLAVNVRNLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSMSSREQFVCLNDG
ECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS
YLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMHSEEMVAIHMTLIVDGRRDEIRQYAPEL
DWISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSF
TETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGE
WHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVYPSSVWSIALQKGYTGCIKNIRMNGVSTKI
GQEFEASNSTGIELGCSLSNELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTK
VSQVEHIKIRFRTTSSRGVLFDTGANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLY
LDGFWSHSIYLQNPISVEIDEVGAAFSVHSSAPPPRDEHFKGFLSKLVFNGNDYLAKTKMNSAQLSKSSSRESKGQRNVK
TRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLMRSALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTT
SPKLPHRQHLSDMRWHNVLIYQDEKTHDHVLLVDNSSTTLIIDKIKKVESKMSGKLYFGSNPLGVSRPSNGFRGCISTLR
INENALDLYEDADSRMKVNRGCSGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYE
YAPNERPTTSKDYFVFSFRTTQPNGVLISIECAADQDYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISR
TEANMTIQVDKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILDL
YENGSNRIHTIGAPQTTAVSEQVSSESEEDDELAEMMMAHSIDENPNEALIESLAPSCLSLEEQQSCFIDTDDSTGFFSP
VLPTVANFPTTRQTEHIDNEVTALITSSLAPQKTRPKSTPHFTVYPVRPTTPMGDTITTTMQAATVTDFPRTPLIMCSSL
AVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRSNDSCTQPLLAKPHINGNGYEPLKGAVIA
NGNGATATMMRNGNGNGVAKKKDFKEWYV
Estimated Isoelectric Point:
6.32874298095703
Estimated Molecular Weight:
173.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr105
Lys71
Gln59
Leu130
Gly96
Met39
Ser162
Tyr48
His51
Glu75
Arg84
Cys30
Phe75
Pro62
Val89
Asn96
Ala72
Ile92
Trp16
Asp97