Sequence:
download
CE47193sequence.fasta
>ATG-2 MTLSTFNRVWCKVMLQRYMGAWLDNNLSVDQLSLELANGCLELDNLDINTKAVSNGFLQCNIPLKLIDGYLGKIKIEIPW LSLMTDPTRMCIEDLQLTFRGAEVMKINDIETLTSMIESVLMGLSTDDMARSVYEEVSKENNVASELLGPDDTADSFSGF IDAVYSRFCLKIKHLTLRFETDPKNRSTMATALEIRVETITFMDEQMRSCEMDHTNATDLVTTQPHGVVSTTNLRKNLTF SGVTFHTDVFSQINNDGMGDEENVLITSMHIRREKAKQMSPTKSVQNSLHPEMFQSAMSDMDAFHSCYDKLTQDYCSPDQ LETLRTAPAEPELFSAPIQCAEVVGDISCVFRIKNGANDVNYADVDESKVETDVFIKGINVFATPSQIEIVNRFFSSIVT PKELVVHEQGKPMSKEDYENMTKNMEPNQSNEPPMAGASFGGNWNVGEVFREFDDLKSIKEKEKSEKEKFKSLKASGNIK EEFTVNTHIGTVLMYIPHCDYMSSDYAQQHGGYANVLNYLKKESESFFKSIQGYSFMSKHGLANIRQQSDSFYPKDHLRI VGGSLGITSSCKRVGNVDSFLCRVVATHFDMLEYLTPESAPENSTPIRIGLLDYSEQENLESDPNFKMVLSTSSEQKGLT KVDILLGAVKTELDFSIIDRISNLIACRPFFDEALTNYGNRNTVPQLKDDLYSDVLIAEDDVKSKTLVNLKCSNWQVDLR IPKADLRDPTGSRLPFSQRHVHNEFLRLGIKEIDVSIPIEKSVTLIEILCTEMIGDFCGEGLNIPKQQQRILHASKNGFD KINLKLTLCSDAKKLPGCGRKTSTSGIPDSMMKSVSADIMMAHPKKEGPFSKVPRSYCSHDGEETEEIIQAGTRKEILDF QEECQNFASTFMLFTVPVLKLHIPEKNFLEILYNRLVNDLALFQPAAPAFRNNQSTNSNVQPLESFQECVSPKNYAESEH SDLDDDVATLHESIESLNFDRDIPHTFVMTLNANKCTVLCNTAIKEAEKQPESSQVSLDLEKVHIGTTAGYHGDINHTYF HFTSSKAAAGSIDSPRAPRIPNLISAKDFGKWTKDCNQLEHVPITDELSSGSTEDAFAVALHMHFRPDVNMKDVLLGIAL RNSQLQAKPFRHWGAFWITQLADLFTLQDYAIPGYELPSVSTDLHICFENAIIGYDHAWVNPNSKLKLRATLGQCNLASS IVSDMNISKTLCIFESCRLYMSNDLTKDAVRFEGYGTQKVSPKKFIPFLDLGSVQLDILFAVGDETGLRTNPTFEIRCQN DIINAWACADSLATFMKTVMEYTSHEQIPIKTPEEESQELMKSTKTDDINKSVAGESVWSDASTGSKHIQKMTVGANLPD DVEKRIQAMIQEAVNENDERDGIAIGEDAVREFATIQPKHDANETNESFEHVASRNFSVTDDEFCMVDDNIFGSGITIQP GESRTRPMPAKQLPEEPLINGSEFFQTIEDSGSDALYQTMSGQINPVLRYFLKDVTVRLSLYAGNDLSTSPSPIKTYCTE EYRNGFGPEQKIEQNSTGGPNRDHSAFVVFELSKITYLKQIFDKTAPMLSTTLFQVNDIVIKDCVRASDIKEMLYQYSVT NQPRRATAPIVTVRMSETHSKEGKMRVSMLPIKINVDQDTLEFLTDFFEETSKLLDLPKNQMSMPLIQRPVIEVPADIGS KKTTPKTSVSSSEGDIARMYPSIPSPSLTLEPLRPSPVQPPTPLGDLTYLEKISSNHQSPVKRPIIDAPLTASAVSIGKI FERDAHSDEDEEEIIDPIQMAAALEIRELNEELGRIEQLEKKKTDDLFKQSYSSSSSETESESSAPQSSQVRRLHESLDA SNPTGLSDLTGDWADDHDLTYTHHDVVRQESPSFNCNISPIKGYSPPAELRPLNLMDSETERDSSASPVTSSPIKPARNI KKELPPLKMPRQPLSNDDILMRSTMMGSVHPSQSVHNLVDTSDDLEEHGNFLDSIDNEDDNEKQKIEEEMEEDEKEEEEE RNKEIQEAVERGETFFKQFVFSPSVNIYVDYQGKRKITMEKAGALVGLLMAFGQLNQMPINLRKIDTRTGLLGTGRCMQH AIGEWSGDLLTNMPSVIASYGPISPLVQIGRGVVDLFLMPVAEFRKDDGNVMKGVQRGVGSFSVSSAAGIVGMAQTVTGF VQSLAEMTMKEIKPDDPSTRRVARRYNRNHGMNPTDVRHSLQLAYGILYDGYHQTRDDLELAAQEDRASGNSVVRSAFRY AVPTFLGPIVMATQVTYQLLGGLRNQLRPDTYQDERRKWGEKDVPGGVNK
view sequence (2290 aa)
>ATG-2
MTLSTFNRVWCKVMLQRYMGAWLDNNLSVDQLSLELANGCLELDNLDINTKAVSNGFLQCNIPLKLIDGYLGKIKIEIPW
LSLMTDPTRMCIEDLQLTFRGAEVMKINDIETLTSMIESVLMGLSTDDMARSVYEEVSKENNVASELLGPDDTADSFSGF
IDAVYSRFCLKIKHLTLRFETDPKNRSTMATALEIRVETITFMDEQMRSCEMDHTNATDLVTTQPHGVVSTTNLRKNLTF
SGVTFHTDVFSQINNDGMGDEENVLITSMHIRREKAKQMSPTKSVQNSLHPEMFQSAMSDMDAFHSCYDKLTQDYCSPDQ
LETLRTAPAEPELFSAPIQCAEVVGDISCVFRIKNGANDVNYADVDESKVETDVFIKGINVFATPSQIEIVNRFFSSIVT
PKELVVHEQGKPMSKEDYENMTKNMEPNQSNEPPMAGASFGGNWNVGEVFREFDDLKSIKEKEKSEKEKFKSLKASGNIK
EEFTVNTHIGTVLMYIPHCDYMSSDYAQQHGGYANVLNYLKKESESFFKSIQGYSFMSKHGLANIRQQSDSFYPKDHLRI
VGGSLGITSSCKRVGNVDSFLCRVVATHFDMLEYLTPESAPENSTPIRIGLLDYSEQENLESDPNFKMVLSTSSEQKGLT
KVDILLGAVKTELDFSIIDRISNLIACRPFFDEALTNYGNRNTVPQLKDDLYSDVLIAEDDVKSKTLVNLKCSNWQVDLR
IPKADLRDPTGSRLPFSQRHVHNEFLRLGIKEIDVSIPIEKSVTLIEILCTEMIGDFCGEGLNIPKQQQRILHASKNGFD
KINLKLTLCSDAKKLPGCGRKTSTSGIPDSMMKSVSADIMMAHPKKEGPFSKVPRSYCSHDGEETEEIIQAGTRKEILDF
QEECQNFASTFMLFTVPVLKLHIPEKNFLEILYNRLVNDLALFQPAAPAFRNNQSTNSNVQPLESFQECVSPKNYAESEH
SDLDDDVATLHESIESLNFDRDIPHTFVMTLNANKCTVLCNTAIKEAEKQPESSQVSLDLEKVHIGTTAGYHGDINHTYF
HFTSSKAAAGSIDSPRAPRIPNLISAKDFGKWTKDCNQLEHVPITDELSSGSTEDAFAVALHMHFRPDVNMKDVLLGIAL
RNSQLQAKPFRHWGAFWITQLADLFTLQDYAIPGYELPSVSTDLHICFENAIIGYDHAWVNPNSKLKLRATLGQCNLASS
IVSDMNISKTLCIFESCRLYMSNDLTKDAVRFEGYGTQKVSPKKFIPFLDLGSVQLDILFAVGDETGLRTNPTFEIRCQN
DIINAWACADSLATFMKTVMEYTSHEQIPIKTPEEESQELMKSTKTDDINKSVAGESVWSDASTGSKHIQKMTVGANLPD
DVEKRIQAMIQEAVNENDERDGIAIGEDAVREFATIQPKHDANETNESFEHVASRNFSVTDDEFCMVDDNIFGSGITIQP
GESRTRPMPAKQLPEEPLINGSEFFQTIEDSGSDALYQTMSGQINPVLRYFLKDVTVRLSLYAGNDLSTSPSPIKTYCTE
EYRNGFGPEQKIEQNSTGGPNRDHSAFVVFELSKITYLKQIFDKTAPMLSTTLFQVNDIVIKDCVRASDIKEMLYQYSVT
NQPRRATAPIVTVRMSETHSKEGKMRVSMLPIKINVDQDTLEFLTDFFEETSKLLDLPKNQMSMPLIQRPVIEVPADIGS
KKTTPKTSVSSSEGDIARMYPSIPSPSLTLEPLRPSPVQPPTPLGDLTYLEKISSNHQSPVKRPIIDAPLTASAVSIGKI
FERDAHSDEDEEEIIDPIQMAAALEIRELNEELGRIEQLEKKKTDDLFKQSYSSSSSETESESSAPQSSQVRRLHESLDA
SNPTGLSDLTGDWADDHDLTYTHHDVVRQESPSFNCNISPIKGYSPPAELRPLNLMDSETERDSSASPVTSSPIKPARNI
KKELPPLKMPRQPLSNDDILMRSTMMGSVHPSQSVHNLVDTSDDLEEHGNFLDSIDNEDDNEKQKIEEEMEEDEKEEEEE
RNKEIQEAVERGETFFKQFVFSPSVNIYVDYQGKRKITMEKAGALVGLLMAFGQLNQMPINLRKIDTRTGLLGTGRCMQH
AIGEWSGDLLTNMPSVIASYGPISPLVQIGRGVVDLFLMPVAEFRKDDGNVMKGVQRGVGSFSVSSAAGIVGMAQTVTGF
VQSLAEMTMKEIKPDDPSTRRVARRYNRNHGMNPTDVRHSLQLAYGILYDGYHQTRDDLELAAQEDRASGNSVVRSAFRY
AVPTFLGPIVMATQVTYQLLGGLRNQLRPDTYQDERRKWGEKDVPGGVNK
Estimated Isoelectric Point:
5.01229095458984
Estimated Molecular Weight:
256.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr144
Lys134
Gln95
Leu191
Gly120
Met74
Ser206
Tyr53
His52
Glu173
Arg100
Cys36
Phe96
Pro120
Val136
Asn118
Ala125
Ile142
Trp14
Asp161