Sequence:
download
CE47057sequence.fasta
>UNC-22, isoform c MGQDFDSDSDSESQLDEIPSSGLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSPPKQDDMFSRDTLLR KTTTSTKNESSTVEEKTKLRKTVKKVDGELDFKAMVKLKKVKKEEGGTTEKSGFPLDHADSTSSVLSQESRSRRGSNAPF AKDGLPEQPANPFAQLKKVKSGAGGLEKSDSMASLKKLDLKKGKIDDNSDGAFKVQLKKVVKKEVKESTISVKEKNGTES GIKTEFKMEKRERTTLQKYEKTDSDGSKKEDKPKKVSIAPVSTNKSSDDEPSTPRHHKEVEEKSTSEELKAKVAGRQVGQ KRNGAQKPEEPKNLLSQIQLKKVTKKAHDDTNELEGIKLKKVTTVPKHVADDDSQSESESRRGSVFGELRRGSRAPRDSA DNSRRDSIRRSSIDMRRESVQEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSRE VISGGRFKHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGG GAGGGGGEKKPMTEAERRQSLFPGKKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVI EKNVCTLIINNPEVDDTGKYTCEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSK AIQEGDPRFIIEKDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVND KDAEVVWWHDGKRIDIDGVKFKVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDD VTLMCQTKDTKTPGIWFRNGKQISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILN WKPKKIEAKAGEPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNS AGTALAPFELFVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLK EHGEYKFRVKALNECGLSDPLTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKD WHQVGQTKPDCCELTDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPI SGEPLPECLWVVNGKPLKAVGRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIA DVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSA DQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKE YQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLT IDTRKNEHTILCIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIE YYEVEKLDTATGRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDA DRVSLEWEPPKSDGGAPITQYVIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVV AKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTL TATNASGSDKHSVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTT VPNLQPGHEYKFRVRAVNKEGESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKD KNGRWEEALVVPGDQKTATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKF IVHIDGEPAPDVTWSFNGKGIGESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPI EVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLET ETDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNE EYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGR VKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPI ENYVIEKYDTASGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITD WDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSAS AVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGT YIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDT NFHVDDLTQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLV EMRTPSGDWVPAVTVGAGELTATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQ TLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPG APEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTS APLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADN LTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATID TGARADVTNTPTSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNG GTDVLHYIVEKMDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEV TDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTD PQITKARYLKPKILTASRKIKIKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGN YKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTG TSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYD IERKDAKTGRWIKVNTSPVQGTAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVK AGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAP ENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSD YCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPG LHENETYQFRVRAVNAAGHGEPSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLG DNDWTRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIR IPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGP IRATDIQADAMTLSWRPPKDNGGDAITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLET DDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPK KTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTD PRVKVEYSDFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSP ITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTV RDKDSTWAELEWDPPRDGGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPS ERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFN DYEFRVVAINAAGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRY RFEASDGVYKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSL VLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATL SWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFD PPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVN DAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQV LIINDLTSDDADEYTCRATNSSGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKI ENNSKFSITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDG GSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDE QGKIVRGKGTVSSNYDNYVFDIWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESD KETVRKEIQTMSVLRHPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYV HLDLKPENIMFTTKRSNELKLIDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFG GENDDETLRNVKSCDWNMDDSAFSGISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDS IKTKYDAWPEPLPPLGRISNYSSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWH KDDRELKQSVKYMKRYNGNDYGLTINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVE EFKERRSAPFFTFHLRNRLIQKNHQCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTV TATNDLGVDVSECVLTVQTKGGEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKIT NELPSFTAQLSDSETEVGGSAEFSAAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRAS NSAGQEQTRATLTVKGDQPLLNGHAGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSI SQDGETLSFTINSADASDAGHYQLEVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQ WFRGSEKIEKNERVKSVKTGNTFKLDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
view sequence (6619 aa)
>UNC-22, isoform c
MGQDFDSDSDSESQLDEIPSSGLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSPPKQDDMFSRDTLLR
KTTTSTKNESSTVEEKTKLRKTVKKVDGELDFKAMVKLKKVKKEEGGTTEKSGFPLDHADSTSSVLSQESRSRRGSNAPF
AKDGLPEQPANPFAQLKKVKSGAGGLEKSDSMASLKKLDLKKGKIDDNSDGAFKVQLKKVVKKEVKESTISVKEKNGTES
GIKTEFKMEKRERTTLQKYEKTDSDGSKKEDKPKKVSIAPVSTNKSSDDEPSTPRHHKEVEEKSTSEELKAKVAGRQVGQ
KRNGAQKPEEPKNLLSQIQLKKVTKKAHDDTNELEGIKLKKVTTVPKHVADDDSQSESESRRGSVFGELRRGSRAPRDSA
DNSRRDSIRRSSIDMRRESVQEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSRE
VISGGRFKHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGG
GAGGGGGEKKPMTEAERRQSLFPGKKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVI
EKNVCTLIINNPEVDDTGKYTCEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSK
AIQEGDPRFIIEKDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVND
KDAEVVWWHDGKRIDIDGVKFKVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDD
VTLMCQTKDTKTPGIWFRNGKQISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILN
WKPKKIEAKAGEPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNS
AGTALAPFELFVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLK
EHGEYKFRVKALNECGLSDPLTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKD
WHQVGQTKPDCCELTDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPI
SGEPLPECLWVVNGKPLKAVGRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIA
DVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSA
DQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKE
YQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLT
IDTRKNEHTILCIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIE
YYEVEKLDTATGRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDA
DRVSLEWEPPKSDGGAPITQYVIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVV
AKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTL
TATNASGSDKHSVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTT
VPNLQPGHEYKFRVRAVNKEGESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKD
KNGRWEEALVVPGDQKTATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKF
IVHIDGEPAPDVTWSFNGKGIGESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPI
EVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLET
ETDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNE
EYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGR
VKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPI
ENYVIEKYDTASGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITD
WDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSAS
AVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGT
YIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDT
NFHVDDLTQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLV
EMRTPSGDWVPAVTVGAGELTATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQ
TLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPG
APEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTS
APLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADN
LTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATID
TGARADVTNTPTSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNG
GTDVLHYIVEKMDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEV
TDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTD
PQITKARYLKPKILTASRKIKIKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGN
YKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTG
TSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYD
IERKDAKTGRWIKVNTSPVQGTAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVK
AGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAP
ENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSD
YCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPG
LHENETYQFRVRAVNAAGHGEPSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLG
DNDWTRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIR
IPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGP
IRATDIQADAMTLSWRPPKDNGGDAITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLET
DDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPK
KTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTD
PRVKVEYSDFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSP
ITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTV
RDKDSTWAELEWDPPRDGGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPS
ERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFN
DYEFRVVAINAAGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRY
RFEASDGVYKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSL
VLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATL
SWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFD
PPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVN
DAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQV
LIINDLTSDDADEYTCRATNSSGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKI
ENNSKFSITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDG
GSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDE
QGKIVRGKGTVSSNYDNYVFDIWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESD
KETVRKEIQTMSVLRHPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYV
HLDLKPENIMFTTKRSNELKLIDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFG
GENDDETLRNVKSCDWNMDDSAFSGISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDS
IKTKYDAWPEPLPPLGRISNYSSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWH
KDDRELKQSVKYMKRYNGNDYGLTINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVE
EFKERRSAPFFTFHLRNRLIQKNHQCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTV
TATNDLGVDVSECVLTVQTKGGEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKIT
NELPSFTAQLSDSETEVGGSAEFSAAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRAS
NSAGQEQTRATLTVKGDQPLLNGHAGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSI
SQDGETLSFTINSADASDAGHYQLEVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQ
WFRGSEKIEKNERVKSVKTGNTFKLDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
Estimated Isoelectric Point:
5.57273101806641
Estimated Molecular Weight:
730.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr456
Lys559
Gln163
Leu363
Gly529
Met63
Ser403
Tyr172
His112
Glu526
Arg340
Cys62
Phe180
Pro479
Val516
Asn296
Ala442
Ile342
Trp111
Asp505