Sequence:
download
CE46967sequence.fasta
>POP-1 MMADEELGDEVKVFRRDEDADDDPMISGETSEQQLADDKKEAVMEAELDGAGRNPSIDVLKSAFPKVEPMSPSFPGLMSH FSPGYSAAALPMFMPLFMNPYAAALRSPSLMFPMGAMSPTFPMFPPSPVYGAAIAAAAAKQHFENMAPLNMRAGHPMNQM GMPPYMHPSSMAPQNVDRRAQGGGKAKKDDHVKKPLNAFMWFMKENRKALLEEIGNNEKQSAELNKELGKRWHDLSKEEQ AKYFEMAKKDKETHKERYPEWSARENYAVNKKKTKKRRDKSIPSENNDQKKCRARFGVNNTEMWCKFCKRKKKCEYATDR SGGSDITDSQDGRGTSGAYSSSSESPSPKANAGIALTTQQQQAAMMHTMLMQMRLGSTTGASTHVPSPLASSSAGRSPLD ANASDSESDVEEEEDEQIDPTVMQQTHDMLMQESMCTI
view sequence (438 aa)
>POP-1
MMADEELGDEVKVFRRDEDADDDPMISGETSEQQLADDKKEAVMEAELDGAGRNPSIDVLKSAFPKVEPMSPSFPGLMSH
FSPGYSAAALPMFMPLFMNPYAAALRSPSLMFPMGAMSPTFPMFPPSPVYGAAIAAAAAKQHFENMAPLNMRAGHPMNQM
GMPPYMHPSSMAPQNVDRRAQGGGKAKKDDHVKKPLNAFMWFMKENRKALLEEIGNNEKQSAELNKELGKRWHDLSKEEQ
AKYFEMAKKDKETHKERYPEWSARENYAVNKKKTKKRRDKSIPSENNDQKKCRARFGVNNTEMWCKFCKRKKKCEYATDR
SGGSDITDSQDGRGTSGAYSSSSESPSPKANAGIALTTQQQQAAMMHTMLMQMRLGSTTGASTHVPSPLASSSAGRSPLD
ANASDSESDVEEEEDEQIDPTVMQQTHDMLMQESMCTI
Estimated Isoelectric Point:
5.89701080322266
Estimated Molecular Weight:
48.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys36
Gln19
Leu22
Gly25
Met33
Ser41
Tyr9
His10
Glu35
Arg20
Cys5
Phe15
Pro32
Val13
Asn19
Ala46
Ile9
Trp4
Asp28