Sequence:
download
CE46888sequence.fasta
>NRX-1, isoform b MRQKFDDTGQYLTIWLVFTVSLFSVVDSIILTGAPDSYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGNFYSL TIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILKNS DVFIGGLPPNMHMLPVMSSPLRRYARHLAVNVRNLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSMSSREQFVCLNDG ECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS YLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMMTLIVDGRRDEIRQYAPELDWISNSFGF LGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTL PRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRL SRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVYPSSVWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNS TGIELGCSLSNELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKI RFRTTSSRGVLFDTGANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLDGFWSHSI YLQNPISVEIDEVGAAFSVHSSAPPPRDEHFKGFLSKLVFNGNDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFT NSTGYVAFSSDKISGLTGSFRVQFKFQTLMRSALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQH LSDMRWHNVLIYQDEKTHDHVLLVDNSSTTLIIDKIKKVESKMSGKLYFGSNPLGVSRPSNGFRGCISTLRINENALDLY EDADSRMKVNRGCSGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTT SKDYFVFSFRTTQPNGVLISIECAADQDYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQV DKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILDLYENGSNRIH TIGAPQTTAVSEQVSSESEEDDELAEMMMAHSIDENPNEALIESLAPSCLSLEEQQSCFIDTDDSTGFFSPVLPTVANFP TTRQTEPETTRRPLSPSKMTPSLPSPTTTTLPVFFLSQITDGDESEDEFDGSGDDLFGGDGVGITAATQPSVKRTTSISV VTKVLTTTSEPSSTHRSTVLPRPYASVKEAAEQNPDYLGASIWNQVDTLPEPMVTGPAWRTNKSLTTTATTEASSTKSNR KTTTTTTTSATTTIRIQQRPNYDIDNEVTALITSSLAPQKTRPKSTPHFTVYPVRPTTPMGDTITTTMQAATVTDFPRTP LIMCSSLAVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRSNDSCTQPLLAKPHINGNGYEP LKGAVIANGNGATATMMRNGNGNGVAKKKDFKEWYV
view sequence (1716 aa)
>NRX-1, isoform b
MRQKFDDTGQYLTIWLVFTVSLFSVVDSIILTGAPDSYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGNFYSL
TIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILKNS
DVFIGGLPPNMHMLPVMSSPLRRYARHLAVNVRNLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSMSSREQFVCLNDG
ECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS
YLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMMTLIVDGRRDEIRQYAPELDWISNSFGF
LGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTL
PRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRL
SRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVYPSSVWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNS
TGIELGCSLSNELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKI
RFRTTSSRGVLFDTGANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLDGFWSHSI
YLQNPISVEIDEVGAAFSVHSSAPPPRDEHFKGFLSKLVFNGNDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFT
NSTGYVAFSSDKISGLTGSFRVQFKFQTLMRSALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQH
LSDMRWHNVLIYQDEKTHDHVLLVDNSSTTLIIDKIKKVESKMSGKLYFGSNPLGVSRPSNGFRGCISTLRINENALDLY
EDADSRMKVNRGCSGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTT
SKDYFVFSFRTTQPNGVLISIECAADQDYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQV
DKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILDLYENGSNRIH
TIGAPQTTAVSEQVSSESEEDDELAEMMMAHSIDENPNEALIESLAPSCLSLEEQQSCFIDTDDSTGFFSPVLPTVANFP
TTRQTEPETTRRPLSPSKMTPSLPSPTTTTLPVFFLSQITDGDESEDEFDGSGDDLFGGDGVGITAATQPSVKRTTSISV
VTKVLTTTSEPSSTHRSTVLPRPYASVKEAAEQNPDYLGASIWNQVDTLPEPMVTGPAWRTNKSLTTTATTEASSTKSNR
KTTTTTTTSATTTIRIQQRPNYDIDNEVTALITSSLAPQKTRPKSTPHFTVYPVRPTTPMGDTITTTMQAATVTDFPRTP
LIMCSSLAVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRSNDSCTQPLLAKPHINGNGYEP
LKGAVIANGNGATATMMRNGNGNGVAKKKDFKEWYV
Estimated Isoelectric Point:
6.27800750732422
Estimated Molecular Weight:
191.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr142
Lys78
Gln65
Leu140
Gly105
Met40
Ser182
Tyr51
His49
Glu82
Arg93
Cys30
Phe79
Pro78
Val98
Asn101
Ala81
Ile97
Trp18
Asp107