Sequence:
download
CE46879sequence.fasta
>DNSN-1, isoform b MSDEHYNPRNRLKTQIKRRSSCRNILNAVPPPPPTDFEGLEGFTDSCPAPTANNPFKVSSPQKKRQKPQVTFSQDDPFAA SISSFRSPDPLKTPTKGVRSSPRKRKSPQKFERFQSFDPALLQEFHPVDFSALLATSSSAQKPAEPAQESAEDLPTDLRI GSKMRIVSKVSFPWMNTRKSTGNVIVKFQTNDRFDGMQYFNKTFLNGYEDPTVPLPVSPMSILEAASLFYQFPVIPGLKM YPRITAEQENVSRVSLAPLVTSTMLEQWQECYAELYSSYKKGQRGSFYVATAVCNVLFTKMPLSGGGDDVAADDTSQSCS QAFRGQKLVAVITHTTSAIREHLRSQGVDFEAPKPTSSLKRVSSSPQLHHDQSTLDCLLASESKENSQMGPTTFGGIENS ENSDESPLKKDQDSDENESPMKLANQWLNEIGVSPRTVKNTVSRELSSQVTDRAGFQCLVVHGSKIHALFNALMDSDVVH EKTGPYTKIPPTLIATSPFLYGQLLSLTKSSNIFAKAGTKCTEYELKLENGPVLPHCAKMMTQFIRSTNMCSTEEKPVTM QVMDRHTSQGMSDWTETATNWNTVTIAENCVKWTKN
view sequence (596 aa)
>DNSN-1, isoform b
MSDEHYNPRNRLKTQIKRRSSCRNILNAVPPPPPTDFEGLEGFTDSCPAPTANNPFKVSSPQKKRQKPQVTFSQDDPFAA
SISSFRSPDPLKTPTKGVRSSPRKRKSPQKFERFQSFDPALLQEFHPVDFSALLATSSSAQKPAEPAQESAEDLPTDLRI
GSKMRIVSKVSFPWMNTRKSTGNVIVKFQTNDRFDGMQYFNKTFLNGYEDPTVPLPVSPMSILEAASLFYQFPVIPGLKM
YPRITAEQENVSRVSLAPLVTSTMLEQWQECYAELYSSYKKGQRGSFYVATAVCNVLFTKMPLSGGGDDVAADDTSQSCS
QAFRGQKLVAVITHTTSAIREHLRSQGVDFEAPKPTSSLKRVSSSPQLHHDQSTLDCLLASESKENSQMGPTTFGGIENS
ENSDESPLKKDQDSDENESPMKLANQWLNEIGVSPRTVKNTVSRELSSQVTDRAGFQCLVVHGSKIHALFNALMDSDVVH
EKTGPYTKIPPTLIATSPFLYGQLLSLTKSSNIFAKAGTKCTEYELKLENGPVLPHCAKMMTQFIRSTNMCSTEEKPVTM
QVMDRHTSQGMSDWTETATNWNTVTIAENCVKWTKN
Estimated Isoelectric Point:
8.34053802490234
Estimated Molecular Weight:
66.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr48
Lys40
Gln32
Leu43
Gly26
Met17
Ser67
Tyr12
His11
Glu34
Arg27
Cys11
Phe28
Pro46
Val36
Asn28
Ala36
Ile19
Trp6
Asp29