Sequence:
download
CE46868sequence.fasta
>UNC-22, isoform g MVGAPRFTQKPSIQQTPTGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLTPLGGSLYKATLVIKEPNAGDGGAYK CTARNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAI FSDLGDQTYLCQLEIRGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRSTASPRPSSRGPGSRPSSPKKS MKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEVSQSESRRSSRTDKMEVDQVSGASKRKPDGLPPPGGDEKKLRAGSP STRKSPSRKSASPTPSRKGSSAGGAASGTTGASASATSATSGGSASSDASRDKYTRPPIVLEASRSQTGRIGGSVVLEVQ WQCHSSTIIEWYRDGTLVRNSSEYSQSFNGSIAKLQVNKLTEEKSGLYKCHAKCDYGEGQSSAMVKIEQSDVEEELMKHR KDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVEHKRSSSVRPDPDEESQLDEIPSS GLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDDKPKKVSIAPVSTNKSSDDEPSTPRRRSSIDMRRESV QEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVAL ALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHSNQQRANSKRESQAGFQKDGEGGGAGGGGGEKKP MTEAERRQSLFPGKKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINN PEVDDTGKYTCEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFII EKDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDG KRIDIDGVKFKVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTK TPGIWFRNGKQISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAG EPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELF VKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKA LNECGLSDPLTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDC CELTDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWV VNGKPLKAVGRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSW NPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWD EPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKA GPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTIL CIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTAT GRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPK SDGGAPITQYVIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWID REAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKH SVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYK FRVRAVNKEGESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVV PGDQKTATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPD VTWSFNGKGIGESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRAT LDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFD RPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNK GGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSK LVVKQMERGDSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTA SGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWK PPANDGGAPIEEYVVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPV IDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGT DTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGH EYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVP AVTVGAGELTATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGE PAPKIEWFLNGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDI TKESVVLKWDEPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVA KNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRV KAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTP TSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEK MDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIK WNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKP KILTASRKIKIKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGE DEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEG HEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRW IKVNTSPVQGTAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPF TASPQPDISWTKEGGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRH TCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKD PFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRV RAVNAAGHGEPSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKP VRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPI IDLFNGNSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAM TLSWRPPKDNGGDAITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFD TPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYN AAGQGEYSVNSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFL ATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDL RHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELE WDPPRDGGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGP PGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINA AGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKF TIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDH PTIRIVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGS KITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIV QVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELD QTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDA DEYTCRATNSSGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTD DKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEK REAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTV SSNYDNYVFDIWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTM SVLRHPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMF TTKRSNELKLIDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNV KSCDWNMDDSAFSGISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEP LPPLGRISNYSSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVK YMKRYNGNDYGLTINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFF TFHLRNRLIQKNHQCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVS ECVLTVQTKGGEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLS DSETEVGGSAEFSAAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRAT LTVKGDQPLLNGHAGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTI NSADASDAGHYQLEVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKN ERVKSVKTGNTFKLDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
view sequence (6848 aa)
>UNC-22, isoform g
MVGAPRFTQKPSIQQTPTGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLTPLGGSLYKATLVIKEPNAGDGGAYK
CTARNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAI
FSDLGDQTYLCQLEIRGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRSTASPRPSSRGPGSRPSSPKKS
MKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEVSQSESRRSSRTDKMEVDQVSGASKRKPDGLPPPGGDEKKLRAGSP
STRKSPSRKSASPTPSRKGSSAGGAASGTTGASASATSATSGGSASSDASRDKYTRPPIVLEASRSQTGRIGGSVVLEVQ
WQCHSSTIIEWYRDGTLVRNSSEYSQSFNGSIAKLQVNKLTEEKSGLYKCHAKCDYGEGQSSAMVKIEQSDVEEELMKHR
KDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVEHKRSSSVRPDPDEESQLDEIPSS
GLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDDKPKKVSIAPVSTNKSSDDEPSTPRRRSSIDMRRESV
QEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVAL
ALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHSNQQRANSKRESQAGFQKDGEGGGAGGGGGEKKP
MTEAERRQSLFPGKKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINN
PEVDDTGKYTCEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFII
EKDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDG
KRIDIDGVKFKVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTK
TPGIWFRNGKQISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAG
EPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELF
VKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKA
LNECGLSDPLTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDC
CELTDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWV
VNGKPLKAVGRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSW
NPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWD
EPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKA
GPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTIL
CIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTAT
GRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPK
SDGGAPITQYVIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWID
REAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKH
SVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYK
FRVRAVNKEGESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVV
PGDQKTATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPD
VTWSFNGKGIGESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRAT
LDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFD
RPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNK
GGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSK
LVVKQMERGDSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTA
SGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWK
PPANDGGAPIEEYVVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPV
IDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGT
DTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGH
EYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVP
AVTVGAGELTATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGE
PAPKIEWFLNGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDI
TKESVVLKWDEPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVA
KNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRV
KAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTP
TSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEK
MDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIK
WNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKP
KILTASRKIKIKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGE
DEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEG
HEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRW
IKVNTSPVQGTAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPF
TASPQPDISWTKEGGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRH
TCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKD
PFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRV
RAVNAAGHGEPSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKP
VRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPI
IDLFNGNSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAM
TLSWRPPKDNGGDAITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFD
TPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYN
AAGQGEYSVNSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFL
ATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDL
RHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELE
WDPPRDGGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGP
PGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINA
AGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKF
TIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDH
PTIRIVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGS
KITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIV
QVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELD
QTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDA
DEYTCRATNSSGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTD
DKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEK
REAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTV
SSNYDNYVFDIWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTM
SVLRHPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMF
TTKRSNELKLIDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNV
KSCDWNMDDSAFSGISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEP
LPPLGRISNYSSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVK
YMKRYNGNDYGLTINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFF
TFHLRNRLIQKNHQCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVS
ECVLTVQTKGGEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLS
DSETEVGGSAEFSAAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRAT
LTVKGDQPLLNGHAGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTI
NSADASDAGHYQLEVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKN
ERVKSVKTGNTFKLDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
Estimated Isoelectric Point:
5.63500213623047
Estimated Molecular Weight:
754.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr466
Lys551
Gln179
Leu372
Gly556
Met67
Ser446
Tyr182
His114
Glu536
Arg363
Cys70
Phe177
Pro507
Val520
Asn305
Ala468
Ile352
Trp115
Asp502