Sequence:
download
CE46855sequence.fasta
>LGC-56, isoform a MLHDVIYMLLISTVAKEVKTESLVDPAHCEYNSNHRKSILTDLLQDYDKTMVPSNNSVQVSVELTVQDISSISEISSSFI ADVWFSQVWYDPRLEYRNISCKTNLSLDSYVSERLWTPNVCFVNSKSTQVHKSPASNILLIIYPNGTVWLNYRVQVSAPC SFELSRFPIDAQECHLVFESYSYNIAEVRLNWQQWAPVTMPPPEDFRLPDFQFYNVTWGKTSNEYTAGMWDQLKVTFRFK RLYGYYVLQMYLPTYLSVFISWIAFWIDTRALPARITLGVSSLMALTFQFGNIVKNLPRVSFVKAIDLWFFVCVAFIFFS LVELAVVGFVDKITEIKRRSRRIKFQRAIAGGTIKNDRPVSFRKYSCTSKCNSVRYNINNNDDEELYNISGETNGNGVSW KNNSSREASADMGARVDSFAAKAFPAMFAAFNVFYWWYYLSRERN
view sequence (445 aa)
>LGC-56, isoform a
MLHDVIYMLLISTVAKEVKTESLVDPAHCEYNSNHRKSILTDLLQDYDKTMVPSNNSVQVSVELTVQDISSISEISSSFI
ADVWFSQVWYDPRLEYRNISCKTNLSLDSYVSERLWTPNVCFVNSKSTQVHKSPASNILLIIYPNGTVWLNYRVQVSAPC
SFELSRFPIDAQECHLVFESYSYNIAEVRLNWQQWAPVTMPPPEDFRLPDFQFYNVTWGKTSNEYTAGMWDQLKVTFRFK
RLYGYYVLQMYLPTYLSVFISWIAFWIDTRALPARITLGVSSLMALTFQFGNIVKNLPRVSFVKAIDLWFFVCVAFIFFS
LVELAVVGFVDKITEIKRRSRRIKFQRAIAGGTIKNDRPVSFRKYSCTSKCNSVRYNINNNDDEELYNISGETNGNGVSW
KNNSSREASADMGARVDSFAAKAFPAMFAAFNVFYWWYYLSRERN
Estimated Isoelectric Point:
8.46817779541016
Estimated Molecular Weight:
51.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys20
Gln14
Leu34
Gly13
Met9
Ser46
Tyr23
His5
Glu20
Arg25
Cys8
Phe29
Pro18
Val40
Asn30
Ala27
Ile27
Trp14
Asp21