Sequence:
download
CE46835sequence.fasta
>NRX-1, isoform a MRQKFDDTGQYLTIWLVFTVSLFSVVDSIILTGAPDSYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGNFYSL TIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILKNS DVFIGGLPPNMHMLPVMSSPLRRYARHLAVNVRNLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSMSSREQFVCLNDG ECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS YLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMMTLIVDGRRDEIRQYAPELDWISNSFGF LGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTL PRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRL SRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVYPSSVWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNS TGIELGCSLSNELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKI RFRTTSSRGVLFDTGANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLDGFWSHSI YLQNPISVEIDEVGAAFSVHSSAPPPRDEHFKGFLSKLVFNGNDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFT NSTGYVAFSSDKISGLTGSFRVQFKFQTLMRSALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQH LSDMRWHNVLIYQDEKTHDHVLLVDNSSTTLIIDKIKKVESKMSGKLYFGSNPLGVSRPSNGFRGCISTLRINENALDLY EDADSRMKVNRGCSGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTT SKDYFVFSFRTTQPNGVLISIECAADQDYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQV DKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILDLYENGSNRIH TIGAPQTTAVSEQVSSESEEDDELAEMMMAHSIDENPNEALIESLAPSCLSLEEQQSCFIDTDDSTGFFSPVLPTVANFP TTRQTEHIDNEVTALITSSLAPQKTRPKSTPHFTVYPVRPTTPMGDTITTTMQAATVTDFPRTPLIMCSSLAVIIAIAAV VFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRSNDSCTQPLLAKPHINGNGYEPLKGAVIANGNGATATM MRNGNGNGVAKKKDFKEWYV
view sequence (1540 aa)
>NRX-1, isoform a
MRQKFDDTGQYLTIWLVFTVSLFSVVDSIILTGAPDSYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGNFYSL
TIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILKNS
DVFIGGLPPNMHMLPVMSSPLRRYARHLAVNVRNLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSMSSREQFVCLNDG
ECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS
YLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMMTLIVDGRRDEIRQYAPELDWISNSFGF
LGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTL
PRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRL
SRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVYPSSVWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNS
TGIELGCSLSNELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKI
RFRTTSSRGVLFDTGANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLDGFWSHSI
YLQNPISVEIDEVGAAFSVHSSAPPPRDEHFKGFLSKLVFNGNDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFT
NSTGYVAFSSDKISGLTGSFRVQFKFQTLMRSALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQH
LSDMRWHNVLIYQDEKTHDHVLLVDNSSTTLIIDKIKKVESKMSGKLYFGSNPLGVSRPSNGFRGCISTLRINENALDLY
EDADSRMKVNRGCSGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTT
SKDYFVFSFRTTQPNGVLISIECAADQDYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQV
DKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILDLYENGSNRIH
TIGAPQTTAVSEQVSSESEEDDELAEMMMAHSIDENPNEALIESLAPSCLSLEEQQSCFIDTDDSTGFFSPVLPTVANFP
TTRQTEHIDNEVTALITSSLAPQKTRPKSTPHFTVYPVRPTTPMGDTITTTMQAATVTDFPRTPLIMCSSLAVIIAIAAV
VFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRSNDSCTQPLLAKPHINGNGYEPLKGAVIANGNGATATM
MRNGNGNGVAKKKDFKEWYV
Estimated Isoelectric Point:
6.37851715087891
Estimated Molecular Weight:
172.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr105
Lys71
Gln59
Leu130
Gly96
Met38
Ser161
Tyr48
His49
Glu73
Arg84
Cys30
Phe75
Pro62
Val88
Asn96
Ala71
Ile91
Trp16
Asp97