Sequence:
download
CE46812sequence.fasta
>NRX-1, isoform g MVFLEHLRGGTPRGTTTVSPILCLMNWNDEQCRQQLKSYIPKFASNFDAPRHVPQPPSSPSYDYEGDEDEEKKEEKDHGI ADRSMNDVSGETTGFFSPVLPTVANFPTTRQTEREFLNIWIRVL
view sequence (124 aa)
>NRX-1, isoform g
MVFLEHLRGGTPRGTTTVSPILCLMNWNDEQCRQQLKSYIPKFASNFDAPRHVPQPPSSPSYDYEGDEDEEKKEEKDHGI
ADRSMNDVSGETTGFFSPVLPTVANFPTTRQTEREFLNIWIRVL
Estimated Isoelectric Point:
4.99488067626953
Estimated Molecular Weight:
14.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys5
Gln5
Leu8
Gly7
Met3
Ser9
Tyr3
His3
Glu11
Arg8
Cys2
Phe7
Pro11
Val7
Asn6
Ala4
Ile5
Trp2
Asp8