Sequence:
download
CE46590sequence.fasta
>NRX-1, isoform h MVTGPAWRTNKSLTTTATTEASSTKSNRKTTTTTTTSATTTIRIQQRPNYDIDNEVTALITSSLAPQKTRPKSTPHFTVY PVRPTTPMGDTITTTMQAATVTDFPRTPLIMCSSLAVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSP PMNHDRSNDSCTQPLLAKPHINGNGYEPLKGAVIANGNGATATMMRNGNGNGVAKKKDFKEWYV
view sequence (224 aa)
>NRX-1, isoform h
MVTGPAWRTNKSLTTTATTEASSTKSNRKTTTTTTTSATTTIRIQQRPNYDIDNEVTALITSSLAPQKTRPKSTPHFTVY
PVRPTTPMGDTITTTMQAATVTDFPRTPLIMCSSLAVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSP
PMNHDRSNDSCTQPLLAKPHINGNGYEPLKGAVIANGNGATATMMRNGNGNGVAKKKDFKEWYV
Estimated Isoelectric Point:
9.70996856689453
Estimated Molecular Weight:
24.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr37
Lys13
Gln7
Leu9
Gly11
Met9
Ser16
Tyr6
His4
Glu6
Arg10
Cys3
Phe6
Pro18
Val12
Asn15
Ala21
Ile12
Trp2
Asp7