Sequence:
download
CE46439sequence.fasta
>NHR-173 MNILHYSPTQTDQLFNNFQYQNHTSPSNSTSSSEGSDQQQIVSDFVDTASFMISWNGLGEFPDTEEDIKHVIQPTENLSL NIEEQKEIVAFHHLPRNVCPTICAVCGDRATGYHYEVPSCNGCKTFFRRTVLSQRKYECMRGGKCFNVLPKEKRCSCRSC RFQKCVEVGMNPFAIQTNDSLSSNAVVTKIVGKRKNSVDNSIPSTSKLTVLPEVISMDNAIDRLIDGLMYLEIKVDDFRS CAYNPPTHEYRSLKYHLEQQPMISMADKLGPMPNWPLRQISHEEMKEYIESGNSEPMTPERKNWFVYDILTSVEYAKTFM FLHQIGKEDQILLLRAVVLKLMHLNQAFYSYENKYDMIFHPDGTVPPHSWKKNENPNDSISQMMTKQKMEEMKEEFTLSI RQFVTYQLDKREYVLFKAITLCNATISGLSDHAREVVTREKEKYSKALMKYCLANRGMKGPAHYAAIIALSNGLENRQKN QKDFHFIMKMMKKGFKFDLVDDVMEEVL
view sequence (508 aa)
>NHR-173
MNILHYSPTQTDQLFNNFQYQNHTSPSNSTSSSEGSDQQQIVSDFVDTASFMISWNGLGEFPDTEEDIKHVIQPTENLSL
NIEEQKEIVAFHHLPRNVCPTICAVCGDRATGYHYEVPSCNGCKTFFRRTVLSQRKYECMRGGKCFNVLPKEKRCSCRSC
RFQKCVEVGMNPFAIQTNDSLSSNAVVTKIVGKRKNSVDNSIPSTSKLTVLPEVISMDNAIDRLIDGLMYLEIKVDDFRS
CAYNPPTHEYRSLKYHLEQQPMISMADKLGPMPNWPLRQISHEEMKEYIESGNSEPMTPERKNWFVYDILTSVEYAKTFM
FLHQIGKEDQILLLRAVVLKLMHLNQAFYSYENKYDMIFHPDGTVPPHSWKKNENPNDSISQMMTKQKMEEMKEEFTLSI
RQFVTYQLDKREYVLFKAITLCNATISGLSDHAREVVTREKEKYSKALMKYCLANRGMKGPAHYAAIIALSNGLENRQKN
QKDFHFIMKMMKKGFKFDLVDDVMEEVL
Estimated Isoelectric Point:
6.76506805419922
Estimated Molecular Weight:
58.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys39
Gln24
Leu37
Gly20
Met24
Ser40
Tyr20
His16
Glu37
Arg22
Cys14
Phe24
Pro24
Val30
Asn31
Ala21
Ile29
Trp4
Asp26