Sequence:
download
CE46427sequence.fasta
>NHR-175 MIVVSRVEKTGIAYSYPPSTPSPEWFPELSENCAVCGDRVHSVRLGSPACLGCIVFFRRAIINVSKYKCLKDGDCLINYE FRSSCRACRLQKCLQVGMKQSAVKRRDCLGPRKVTPPTAASTPPVVQRKPESYIIQNLVKIQDRHFEEHRDQSVSEFRRA TVSDVNKVLKWSINNAIEWASQFSPFQLIMNEDQKCVISEYGFAFLVVDQAFRTISETPNGCWYLQNGTYLNSDYLYGLT DEAAKFSNSSIRKHSEFVKSLEKTIKIPFEIMDIDTFEIAALKSLLLVSPSFPKWTIFADYQEKMVSLKNKCLNELMEYL QLNYPDTFMERYGQLILLLGNIRCAVKLVYNQTKVSDLFNAYKFDLYVRSFILT
view sequence (374 aa)
>NHR-175
MIVVSRVEKTGIAYSYPPSTPSPEWFPELSENCAVCGDRVHSVRLGSPACLGCIVFFRRAIINVSKYKCLKDGDCLINYE
FRSSCRACRLQKCLQVGMKQSAVKRRDCLGPRKVTPPTAASTPPVVQRKPESYIIQNLVKIQDRHFEEHRDQSVSEFRRA
TVSDVNKVLKWSINNAIEWASQFSPFQLIMNEDQKCVISEYGFAFLVVDQAFRTISETPNGCWYLQNGTYLNSDYLYGLT
DEAAKFSNSSIRKHSEFVKSLEKTIKIPFEIMDIDTFEIAALKSLLLVSPSFPKWTIFADYQEKMVSLKNKCLNELMEYL
QLNYPDTFMERYGQLILLLGNIRCAVKLVYNQTKVSDLFNAYKFDLYVRSFILT
Estimated Isoelectric Point:
8.72441864013672
Estimated Molecular Weight:
43.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys26
Gln16
Leu34
Gly13
Met7
Ser33
Tyr17
His4
Glu22
Arg21
Cys14
Phe21
Pro18
Val28
Asn18
Ala20
Ile24
Trp5
Asp17