Sequence:
download
CE46415sequence.fasta
>UNC-52, isoform g MLPSVHRDDEGSYTCEIVKEENPVFSTVDLQIDDFIPVIDGEPIELPPLSDEEIVNLDIEITLNTANPKGIIFETKRINS GDLLATPYDTIHHEAKITDYGTVLYEFDIGNGRQIVETTNPINPNEWNVIKIKNDKNQVTIQLNDESATIRQHTNPLPSL STGVNRPVFIGGRHEPTNEANDFRGIISQVVLSGHNVGLGDARIPSSVVKYDACASTNLCLNGANCRNANNHHGFSCECA EEFHGEYCQWRSNSCHDESCNTGICLDNEESWQCVCPLGTTGLRCEEKTEIPQPLGFTSDTSFLAVKRPVKFESIKMKLR PQADSDEHILMYFASDYGSNTKQYTSLSLIANQVVLTVRRPDKEVQKIRSETLEAGELIDVAVRQAGNALVMTVDGNQVS TIETDTLKPGTEIFIGGLPPGLNSPDDVVEQSFQGCVYEILINSQDVDLQNLSSSGDISSCEESQFPVEEDDTTTTTTTE EPEAVIEEPTTEEPTTTEEPITEEPTEEPTTTEEPTTTEEPTTTTEEPTTTTTEEPYHIYETSRDDDPEIIIPVETTTTS TTTTSTTEEPEAEPALVLPTDPVEENDVSDEEEEISTISTVSPDNGLDSDSDYSEGTLPPDSSSEEIVVGDVYSTQEPNN ICANSTCGMNGQCVPRNMTHYTCECKLYYDGPTCSLFKPIEHAARFDGDAFIELSSDEFPHLTSEKDEIVAFKFKTEQQN GVLLWQGQRPTVQQMEDYISVGIVNGHLHFSYELGGGAAHLISEERVDDGKEHSVRFERKGREGQMRIDNYREVDGRSTG ILAMLNVDGNIFVGGVPDISKATGGLFSNNFVGCIADVELNGVKLDLMATAIDGKNVKPCDEWMHRKRWLYRRRVR
view sequence (876 aa)
>UNC-52, isoform g
MLPSVHRDDEGSYTCEIVKEENPVFSTVDLQIDDFIPVIDGEPIELPPLSDEEIVNLDIEITLNTANPKGIIFETKRINS
GDLLATPYDTIHHEAKITDYGTVLYEFDIGNGRQIVETTNPINPNEWNVIKIKNDKNQVTIQLNDESATIRQHTNPLPSL
STGVNRPVFIGGRHEPTNEANDFRGIISQVVLSGHNVGLGDARIPSSVVKYDACASTNLCLNGANCRNANNHHGFSCECA
EEFHGEYCQWRSNSCHDESCNTGICLDNEESWQCVCPLGTTGLRCEEKTEIPQPLGFTSDTSFLAVKRPVKFESIKMKLR
PQADSDEHILMYFASDYGSNTKQYTSLSLIANQVVLTVRRPDKEVQKIRSETLEAGELIDVAVRQAGNALVMTVDGNQVS
TIETDTLKPGTEIFIGGLPPGLNSPDDVVEQSFQGCVYEILINSQDVDLQNLSSSGDISSCEESQFPVEEDDTTTTTTTE
EPEAVIEEPTTEEPTTTEEPITEEPTEEPTTTEEPTTTEEPTTTTEEPTTTTTEEPYHIYETSRDDDPEIIIPVETTTTS
TTTTSTTEEPEAEPALVLPTDPVEENDVSDEEEEISTISTVSPDNGLDSDSDYSEGTLPPDSSSEEIVVGDVYSTQEPNN
ICANSTCGMNGQCVPRNMTHYTCECKLYYDGPTCSLFKPIEHAARFDGDAFIELSSDEFPHLTSEKDEIVAFKFKTEQQN
GVLLWQGQRPTVQQMEDYISVGIVNGHLHFSYELGGGAAHLISEERVDDGKEHSVRFERKGREGQMRIDNYREVDGRSTG
ILAMLNVDGNIFVGGVPDISKATGGLFSNNFVGCIADVELNGVKLDLMATAIDGKNVKPCDEWMHRKRWLYRRRVR
Estimated Isoelectric Point:
4.33713531494141
Estimated Molecular Weight:
96.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr87
Lys29
Gln29
Leu55
Gly58
Met11
Ser63
Tyr21
His20
Glu96
Arg34
Cys23
Phe26
Pro53
Val60
Asn50
Ala34
Ile59
Trp6
Asp62