Sequence:
download
CE46329sequence.fasta
>NCBP-2, isoform a MVFDPRTLDNPKEISAYRDQRYQGTVRDQETALRTSCTLYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGF CFVEYYTREDAELALQNISNTRMDDRVIRADWDAGFIEGRQYGRGKHGGQVRDEYRKDYDPERGGYNRAIAQKGGDRQ
view sequence (158 aa)
>NCBP-2, isoform a
MVFDPRTLDNPKEISAYRDQRYQGTVRDQETALRTSCTLYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGF
CFVEYYTREDAELALQNISNTRMDDRVIRADWDAGFIEGRQYGRGKHGGQVRDEYRKDYDPERGGYNRAIAQKGGDRQ
Estimated Isoelectric Point:
7.65064239501953
Estimated Molecular Weight:
18.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys7
Gln9
Leu8
Gly16
Met3
Ser4
Tyr12
His1
Glu10
Arg20
Cys3
Phe6
Pro4
Val9
Asn5
Ala9
Ile6
Trp1
Asp16