Sequence:
download
CE46178sequence.fasta
>LGC-10, isoform a MDNETSAILNDIFVGYDRRVLPFVQGPVLVNMTIVLGILIELKENQQLAAYVISHTQRWYDGRLSWDPSKYRGQREVIVP QTMVWIPKLFVYNSLESKDMLTENRADVRLYHNGRIKINIPQYVQAICRIQTESFPFDCQFCAVALASPLLNVNEMVVNA TQPPRDSYFSGNAEWYLFNVTVRHMTFEEEGESRVEIHYVFHLQRRPIYYITVIVAPTFLISALSILGIFSPGSNDGPRN EKVSLGLGSLLAMTVLLGIVAGAMPKSNDIPLLGYYILAVIVLCAVAVAISMMFLAVTRHYIQKEQMPSKRILRFLFLHE YRKRRSTVFRGVHNYRFNQECDDLMYSKVPEIQSICMMMEEIADSHRSMRRKADMKANKKMIEREWARVFARFDYFFLAA FETLNLSALVIFLRTAWLPTPELREQIL
view sequence (428 aa)
>LGC-10, isoform a
MDNETSAILNDIFVGYDRRVLPFVQGPVLVNMTIVLGILIELKENQQLAAYVISHTQRWYDGRLSWDPSKYRGQREVIVP
QTMVWIPKLFVYNSLESKDMLTENRADVRLYHNGRIKINIPQYVQAICRIQTESFPFDCQFCAVALASPLLNVNEMVVNA
TQPPRDSYFSGNAEWYLFNVTVRHMTFEEEGESRVEIHYVFHLQRRPIYYITVIVAPTFLISALSILGIFSPGSNDGPRN
EKVSLGLGSLLAMTVLLGIVAGAMPKSNDIPLLGYYILAVIVLCAVAVAISMMFLAVTRHYIQKEQMPSKRILRFLFLHE
YRKRRSTVFRGVHNYRFNQECDDLMYSKVPEIQSICMMMEEIADSHRSMRRKADMKANKKMIEREWARVFARFDYFFLAA
FETLNLSALVIFLRTAWLPTPELREQIL
Estimated Isoelectric Point:
8.75635528564453
Estimated Molecular Weight:
49.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys15
Gln17
Leu43
Gly17
Met18
Ser26
Tyr19
His9
Glu26
Arg32
Cys6
Phe23
Pro20
Val36
Asn20
Ala29
Ile33
Trp6
Asp16