Sequence:
download
CE45752sequence.fasta
>COL-40 MEEKQKIAEAESLKKLAFFGISVSTIATLTAIIAVPMLYNYMQHVQSSLQNEVEFCKHRTDGLWDEFHRFETVKGVDSRI KRDTRSRRGGYAEGGAAAGGGGGGGGSCCSCGIGAAGPAGAPGKDGAPGEDGKAGNPGTAGSDAEAAAAPTASDFCFDCP PGPAGPAGGPGPAGPPGPAGADGNTPSGGGEGPAGPPGPPGPAGNPGTDGAPGNPGAPGQVTETPGTPGPAGAAGPPGPP GPAGNPGSAGASEPGPAGPAGDAGPDGAPGNAGAPGAPGEAGAPGSGGGCDHCPPPRTAPGY
view sequence (302 aa)
>COL-40
MEEKQKIAEAESLKKLAFFGISVSTIATLTAIIAVPMLYNYMQHVQSSLQNEVEFCKHRTDGLWDEFHRFETVKGVDSRI
KRDTRSRRGGYAEGGAAAGGGGGGGGSCCSCGIGAAGPAGAPGKDGAPGEDGKAGNPGTAGSDAEAAAAPTASDFCFDCP
PGPAGPAGGPGPAGPPGPAGADGNTPSGGGEGPAGPPGPPGPAGNPGTDGAPGNPGAPGQVTETPGTPGPAGAAGPPGPP
GPAGNPGSAGASEPGPAGPAGDAGPDGAPGNAGAPGAPGEAGAPGSGGGCDHCPPPRTAPGY
Estimated Isoelectric Point:
4.68672943115234
Estimated Molecular Weight:
28.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys9
Gln5
Leu6
Gly72
Met3
Ser15
Tyr4
His4
Glu15
Arg8
Cys8
Phe7
Pro47
Val7
Asn8
Ala48
Ile7
Trp1
Asp14