Sequence:
download
CE45725sequence.fasta
>LGC-4 MIICYSCLTVSILLTIKFVPCRFAGIEHQNTKSRVHFSLLDSRQENDTNHFEIAEAKFQKPHNEENTIGTITKFAPSVQE QHSSAVIPMPHFDQNRLEQALRIKGSIDGTEEALYRSLLDHTVYEKDVRPCIHHSQPTNVTFGFLLNQIVEMDERNQALT TRSWLNINWMDPRLSWNESLWSEIKAIYIPHARIWKPDIILVNNAIREYYASLVSTDVMVTSDGNVTWLFSALFRSSCPI RVRYYPFDDQQCDLKFASWSHDITEINLGLNTDKGDLSSYMNNSEFDLVDMTAVREVVTFPSDTNSDWPIIVIRIHMHRR PLFYVFNHIVPCVLISSMAVLGFLMPPETGEKINMIITTLLSMGVYLQSITESIPPTSEGVPLIGMYYVSSLLMVCLATC VNVITLNMHRNGAANQGRHVPAWMQKWILGYLATFMRMSIREPDSIALLKASQSKKSTIRRSSILRDLKRVKNMSNVRAK SKEQNANRECECMDPLVHIYAESIMSCLAADTKPMNGSTIREDFASESTFLGRVVSDGIMPRISASSNSVLTEFETRFRR ILKRVYRSLQQHEIREEILDERSRIQWQWQQLASVVDRLLLCLFCTATLFTIICLLIVPVAYRDNDSMLSFLNFF
view sequence (635 aa)
>LGC-4
MIICYSCLTVSILLTIKFVPCRFAGIEHQNTKSRVHFSLLDSRQENDTNHFEIAEAKFQKPHNEENTIGTITKFAPSVQE
QHSSAVIPMPHFDQNRLEQALRIKGSIDGTEEALYRSLLDHTVYEKDVRPCIHHSQPTNVTFGFLLNQIVEMDERNQALT
TRSWLNINWMDPRLSWNESLWSEIKAIYIPHARIWKPDIILVNNAIREYYASLVSTDVMVTSDGNVTWLFSALFRSSCPI
RVRYYPFDDQQCDLKFASWSHDITEINLGLNTDKGDLSSYMNNSEFDLVDMTAVREVVTFPSDTNSDWPIIVIRIHMHRR
PLFYVFNHIVPCVLISSMAVLGFLMPPETGEKINMIITTLLSMGVYLQSITESIPPTSEGVPLIGMYYVSSLLMVCLATC
VNVITLNMHRNGAANQGRHVPAWMQKWILGYLATFMRMSIREPDSIALLKASQSKKSTIRRSSILRDLKRVKNMSNVRAK
SKEQNANRECECMDPLVHIYAESIMSCLAADTKPMNGSTIREDFASESTFLGRVVSDGIMPRISASSNSVLTEFETRFRR
ILKRVYRSLQQHEIREEILDERSRIQWQWQQLASVVDRLLLCLFCTATLFTIICLLIVPVAYRDNDSMLSFLNFF
Estimated Isoelectric Point:
6.66114044189453
Estimated Molecular Weight:
72.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr38
Lys22
Gln23
Leu60
Gly19
Met24
Ser60
Tyr17
His18
Glu36
Arg42
Cys15
Phe28
Pro27
Val42
Asn34
Ala33
Ile54
Trp12
Asp31