Sequence:
download
CE45651sequence.fasta
>GCY-13 MASSVGWQTSASAIEIAMDRIKSEHLIDNIGINFIYVFDDCNEAKAAGLSSKLLMDANVSAIVGPTCNAAGLAVVNLAGY YNTPVLTWGLTISSSFIDTSKYPTTVTIVPVAKSIAAAIHEVMIQFEWTEFVYVFVEDEKCGYFRDDLEQITSDSNYTSL SRTIQIYDQSYTNLVRQLEKLKTVSRIFTVCLPEAGDIKRRFMLAAYDLDMTTDEYVYLFAGPKSTAYQQTSSTGDVVGI WVDWSENPDGRDEEAKLAFMRTMVIVATPVQGEQYAAFKKEVIERMKLPPYNCVDECKEKEYQEAAEYADQLHDTIYLYA LILNKTIEEQGIEQIANGSNIVTRGAGIEFEGMSGVVRMNGIGYRLPNMNLANLDSNATQRTVAYMDIDSTSVNWTFAII DQALIWDAYNGKLPQTRPECGYSGKSCPVNFFVDYLYIVVIVAVIIVLCCAAAAIAAFLVIKARRDEELRLDDQWIVPHG MLQSIIKGRKESHHSSRSLQSNSTTTTGTTGISSRSVFFPETETQGYFVYMNEPVLARKYQLRVPIFKQDRSELRMLRSI EHDNVNRFIGLSIDGPVYMSFWRYCSRGSIKDVIAKSSINMDGFFIYCLIKDIASGLQYIHHSPIKQHGSLTSECCYIND RWQVKIGSYGLSFMQGVEKRTEDGLLHTAPEVLREGLTSGTQAGDVYSFSIVCSELVGHSSAWNLENRKEEADEIIFMVK RGGRTPFRPSLDDVDDDINPAMLHLIRDCWDEDPKQRPNIDMVNKLMKNMNSGRSGSANLMDHVFSVLEKHASSLEDEVQ ERMKELVEEKKKSDILLYRMLPQQVAERLKLGQSVEPEAFESVTIFFSDVVGFTVLANKSTPLQVVNLLNDLYTTFDAII EKNDSYKVETIGDAYLVVSGLPRRNGTEHVANIANMSLELMDSLQAFKIPHLPQEKVQIRIGMHSGSCVAGVVGLTMPRY CLFGDTVNTASRMESNGKPGFIHLSSDCYDLLTSLYKEYNTESRGEVIIKGKGVMQTYWLLGMKEESA
view sequence (1028 aa)
>GCY-13
MASSVGWQTSASAIEIAMDRIKSEHLIDNIGINFIYVFDDCNEAKAAGLSSKLLMDANVSAIVGPTCNAAGLAVVNLAGY
YNTPVLTWGLTISSSFIDTSKYPTTVTIVPVAKSIAAAIHEVMIQFEWTEFVYVFVEDEKCGYFRDDLEQITSDSNYTSL
SRTIQIYDQSYTNLVRQLEKLKTVSRIFTVCLPEAGDIKRRFMLAAYDLDMTTDEYVYLFAGPKSTAYQQTSSTGDVVGI
WVDWSENPDGRDEEAKLAFMRTMVIVATPVQGEQYAAFKKEVIERMKLPPYNCVDECKEKEYQEAAEYADQLHDTIYLYA
LILNKTIEEQGIEQIANGSNIVTRGAGIEFEGMSGVVRMNGIGYRLPNMNLANLDSNATQRTVAYMDIDSTSVNWTFAII
DQALIWDAYNGKLPQTRPECGYSGKSCPVNFFVDYLYIVVIVAVIIVLCCAAAAIAAFLVIKARRDEELRLDDQWIVPHG
MLQSIIKGRKESHHSSRSLQSNSTTTTGTTGISSRSVFFPETETQGYFVYMNEPVLARKYQLRVPIFKQDRSELRMLRSI
EHDNVNRFIGLSIDGPVYMSFWRYCSRGSIKDVIAKSSINMDGFFIYCLIKDIASGLQYIHHSPIKQHGSLTSECCYIND
RWQVKIGSYGLSFMQGVEKRTEDGLLHTAPEVLREGLTSGTQAGDVYSFSIVCSELVGHSSAWNLENRKEEADEIIFMVK
RGGRTPFRPSLDDVDDDINPAMLHLIRDCWDEDPKQRPNIDMVNKLMKNMNSGRSGSANLMDHVFSVLEKHASSLEDEVQ
ERMKELVEEKKKSDILLYRMLPQQVAERLKLGQSVEPEAFESVTIFFSDVVGFTVLANKSTPLQVVNLLNDLYTTFDAII
EKNDSYKVETIGDAYLVVSGLPRRNGTEHVANIANMSLELMDSLQAFKIPHLPQEKVQIRIGMHSGSCVAGVVGLTMPRY
CLFGDTVNTASRMESNGKPGFIHLSSDCYDLLTSLYKEYNTESRGEVIIKGKGVMQTYWLLGMKEESA
Estimated Isoelectric Point:
5.14366912841797
Estimated Molecular Weight:
115.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr58
Lys51
Gln38
Leu82
Gly64
Met34
Ser85
Tyr44
His19
Glu70
Arg48
Cys19
Phe38
Pro34
Val79
Asn46
Ala68
Ile76
Trp13
Asp62