Sequence:
download
CE45317sequence.fasta
>NRX-1, isoform d MMMAHSIDENPNEALIESLAPSCLSLEEQQSCFIDTDDSTGFFSPVLPTVANFPTTRQTEHIDNEVTALITSSLAPQKTR PKSTPHFTVYPVRPTTPMGDTITTTMQAATVTDFPRTPLIMCSSLAVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSG YTAIAPELSPPMNHDRSNDSCTQPLLAKPHINGNGYEPLKGAVIANGNGATATMMRNGNGNGVAKKKDFKEWYV
view sequence (234 aa)
>NRX-1, isoform d
MMMAHSIDENPNEALIESLAPSCLSLEEQQSCFIDTDDSTGFFSPVLPTVANFPTTRQTEHIDNEVTALITSSLAPQKTR
PKSTPHFTVYPVRPTTPMGDTITTTMQAATVTDFPRTPLIMCSSLAVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSG
YTAIAPELSPPMNHDRSNDSCTQPLLAKPHINGNGYEPLKGAVIANGNGATATMMRNGNGNGVAKKKDFKEWYV
Estimated Isoelectric Point:
5.84114837646484
Estimated Molecular Weight:
25.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr25
Lys10
Gln8
Leu13
Gly11
Met11
Ser18
Tyr5
His6
Glu11
Arg7
Cys5
Phe10
Pro21
Val13
Asn15
Ala21
Ile13
Trp1
Asp10