Sequence:
download
CE45301sequence.fasta
>NRX-1, isoform c MMMAHSIDENPNEALIESLAPSCLSLEEQQSCFIDTDDSTGFFSPVLPTVANFPTTRQTEPETTRRPLSPSKMTPSLPSP TTTTLPVFFLSQITDGDESEDEFDGSGDDLFGGDGVGITAATQPSVKRTTSISVVTKVLTTTSEPSSTHRSTVLPRPYAS VKEAAEQNPDYLGASIWNQVDTLPEPMVTGPAWRTNKSLTTTATTEASSTKSNRKTTTTTTTSATTTIRIQQRPNYDIDN EVTALITSSLAPQKTRPKSTPHFTVYPVRPTTPMGDTITTTMQAATVTDFPRTPLIMCSSLAVIIAIAAVVFFVFKCRQN PPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRSNDSCTQPLLAKPHINGNGYEPLKGAVIANGNGATATMMRNGNGNGVA KKKDFKEWYV
view sequence (410 aa)
>NRX-1, isoform c
MMMAHSIDENPNEALIESLAPSCLSLEEQQSCFIDTDDSTGFFSPVLPTVANFPTTRQTEPETTRRPLSPSKMTPSLPSP
TTTTLPVFFLSQITDGDESEDEFDGSGDDLFGGDGVGITAATQPSVKRTTSISVVTKVLTTTSEPSSTHRSTVLPRPYAS
VKEAAEQNPDYLGASIWNQVDTLPEPMVTGPAWRTNKSLTTTATTEASSTKSNRKTTTTTTTSATTTIRIQQRPNYDIDN
EVTALITSSLAPQKTRPKSTPHFTVYPVRPTTPMGDTITTTMQAATVTDFPRTPLIMCSSLAVIIAIAAVVFFVFKCRQN
PPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRSNDSCTQPLLAKPHINGNGYEPLKGAVIANGNGATATMMRNGNGNGVA
KKKDFKEWYV
Estimated Isoelectric Point:
5.47521209716797
Estimated Molecular Weight:
44.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr62
Lys17
Gln14
Leu23
Gly20
Met13
Ser39
Tyr8
His6
Glu20
Arg16
Cys5
Phe14
Pro37
Val23
Asn20
Ala31
Ile19
Trp3
Asp20