Sequence:
download
CE45165sequence.fasta
>DCS-1, isoform b MLYNMRDKSLEAINQKYGLKTDQIKCYFHYQPSFYHLHVHFINLKYDAPASTTMSAILLDDVINNLELNPEHYKKSTLTF TRKNGDKLMEMFREALKN
view sequence (98 aa)
>DCS-1, isoform b
MLYNMRDKSLEAINQKYGLKTDQIKCYFHYQPSFYHLHVHFINLKYDAPASTTMSAILLDDVINNLELNPEHYKKSTLTF
TRKNGDKLMEMFREALKN
Estimated Isoelectric Point:
8.64815521240234
Estimated Molecular Weight:
11.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys10
Gln3
Leu12
Gly2
Met5
Ser5
Tyr7
His5
Glu5
Arg3
Cys1
Phe5
Pro3
Val2
Asn8
Ala5
Ile5
Asp6