Sequence:
download
CE44814sequence.fasta
>TIMM-17B.2, isoform a MREVRMRSTLAGVQFAAWGGLFSTIDCCLVANRKKEDSINSIVSGGLTGALLAIRSPKMERIRLEVIELGELMGYVHLQK KVPKAHVNSLLILIDTLSIRAIDVKDTLAESDIEEFNSVVEEVLAAMRRDCLTMPQRVLE
view sequence (140 aa)
>TIMM-17B.2, isoform a
MREVRMRSTLAGVQFAAWGGLFSTIDCCLVANRKKEDSINSIVSGGLTGALLAIRSPKMERIRLEVIELGELMGYVHLQK
KVPKAHVNSLLILIDTLSIRAIDVKDTLAESDIEEFNSVVEEVLAAMRRDCLTMPQRVLE
Estimated Isoelectric Point:
6.13530731201172
Estimated Molecular Weight:
15.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys7
Gln3
Leu18
Gly8
Met6
Ser10
Tyr1
His2
Glu12
Arg11
Cys3
Phe3
Pro3
Val13
Asn4
Ala11
Ile11
Trp1
Asp7