Sequence:
download
CE44782sequence.fasta
>LIN-18 MILRYLIFFAQLWALCLANVNMFISKEEMNRTFGVKAELNYIEMGNVSSYSTKFHYRVMANIDYLSFTWNAVGIVHYEVY VESDDSSVLPIVRIPLKGTVPESLQDFTVEYRCAGHRSGQFAVSLYFTFKYGNKEPLKVKLRQEKICASRDGRRGLNGGY EGHEVDDTDSIDKAFFVIICIAAAFLLIVAATLICYFKRSKKEDMIPTRLPTSFRNSLKSTKSAQPFLLSTPRDGPPTLS AISSAPCSSSSASGNSIIPSKPRNIDVRRALLQLYQDRDAFQSLPLDMEGTFGEVRYAIWRQVDDVLNGDVDDEEDTFCN QEAVYTKTLKNNASPIQLDRFLSDALLFYNITPHQNLSQVACVASFGRFDRPETVTDFPLVCYRHQGFGNLKKFLTICRH GDKTKGAQTLRTHQLVSLATQVSSAVAHIHKYRIVHNDIAARNCLIAEVNGRLQVQLCDSALSRDLFPADYHCLGDNENR PLKWMSPEAIANELYSSAADVWSLGVLLWELMSLGGSPHAEIDPEEVYTMILKGKRLQQPNNCPDQLYEVMLCCWRVLSE DRPSSEQVVHGLRDFNIQLSQYI
view sequence (583 aa)
>LIN-18
MILRYLIFFAQLWALCLANVNMFISKEEMNRTFGVKAELNYIEMGNVSSYSTKFHYRVMANIDYLSFTWNAVGIVHYEVY
VESDDSSVLPIVRIPLKGTVPESLQDFTVEYRCAGHRSGQFAVSLYFTFKYGNKEPLKVKLRQEKICASRDGRRGLNGGY
EGHEVDDTDSIDKAFFVIICIAAAFLLIVAATLICYFKRSKKEDMIPTRLPTSFRNSLKSTKSAQPFLLSTPRDGPPTLS
AISSAPCSSSSASGNSIIPSKPRNIDVRRALLQLYQDRDAFQSLPLDMEGTFGEVRYAIWRQVDDVLNGDVDDEEDTFCN
QEAVYTKTLKNNASPIQLDRFLSDALLFYNITPHQNLSQVACVASFGRFDRPETVTDFPLVCYRHQGFGNLKKFLTICRH
GDKTKGAQTLRTHQLVSLATQVSSAVAHIHKYRIVHNDIAARNCLIAEVNGRLQVQLCDSALSRDLFPADYHCLGDNENR
PLKWMSPEAIANELYSSAADVWSLGVLLWELMSLGGSPHAEIDPEEVYTMILKGKRLQQPNNCPDQLYEVMLCCWRVLSE
DRPSSEQVVHGLRDFNIQLSQYI
Estimated Isoelectric Point:
6.29381561279297
Estimated Molecular Weight:
65.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys26
Gln25
Leu60
Gly29
Met11
Ser49
Tyr23
His14
Glu30
Arg35
Cys16
Phe28
Pro26
Val40
Asn28
Ala41
Ile33
Trp7
Asp36