Sequence:
download
CE44668sequence.fasta
>UNC-22, isoform e MFSRDTLLRKTTTSTKNESSTVEEKTKLRKTVKKVDGELDFKAMVKLKKVKKEEGGTTEKSGFPLDHADSTSSVLSQESR SRRGSNAPFAKDGLPEQPANPFAQLKKVKSGAGGLEKSDSMASLKKLDLKKGKIDDNSDGAFKVQLKKVVKKEVKESTIS VKEKNGTESGIKTEFKMEKRERTTLQKYEKTDSDGSKKEDKPKKVSIAPVSTNKSSDDEPSTPRRRSSIDMRRESVQEIL EKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALALLK CRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSLFPG KKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYTCEA NGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFIIEKDAVGRCTLTIK EVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKFKVE SSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQIS SMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQIKG TRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKGPLE TKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKALNECGLSDPLTGE SVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDKKVVEDKE YLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVGRVK MSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTG YIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDF DADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQL AKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMRSDVGEY RLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTK AHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQYVIE KKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIKVGN DVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVLGKPSSP LGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYKFRVRAVNKEGESD PLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQKTATVPNLK EGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGIGES KAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEP IEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEPTDW DSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAV IAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGT FTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTASGRWVPAAKVAGD KTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPIEEY VVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIKVKA GQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHP SSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVNRHG DSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAGELTATV DGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSP LSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPL DDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDV TPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPGKPSD PTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTPTSSAIHIFSAVRG DTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQEVGT FPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVT GYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIKIKA GFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQDRP SAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTF GRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQGTAF SDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKE GGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDG GAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEI TGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSN GSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKNLGE KEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFEN ERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGD AITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVET SEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVNSVP ITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFLATLTIEKSELTDG GLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSF VRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPRDGGSKIIG YQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIG RNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPI KIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKFTIKEVWDIDAGEY TVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDDHIL ITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLS KDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQR PLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGP KIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATNSSGT RSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRISNASR EDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAK SRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVFDIWK QYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLVNLHD AFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELKLIDF GLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDDSAFS GISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEPLPPLGRISNYSSL RKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGNDYGLT INRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFFTFHLRNRLIQKNH QCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVSECVLTVQTKGGEP IPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLSDSETEVGGSAEFS AAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRATLTVKGDQPLLNGH AGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTINSADASDAGHYQL EVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKNERVKSVKTGNTFK LDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
view sequence (6435 aa)
>UNC-22, isoform e
MFSRDTLLRKTTTSTKNESSTVEEKTKLRKTVKKVDGELDFKAMVKLKKVKKEEGGTTEKSGFPLDHADSTSSVLSQESR
SRRGSNAPFAKDGLPEQPANPFAQLKKVKSGAGGLEKSDSMASLKKLDLKKGKIDDNSDGAFKVQLKKVVKKEVKESTIS
VKEKNGTESGIKTEFKMEKRERTTLQKYEKTDSDGSKKEDKPKKVSIAPVSTNKSSDDEPSTPRRRSSIDMRRESVQEIL
EKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALALLK
CRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSLFPG
KKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYTCEA
NGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFIIEKDAVGRCTLTIK
EVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKFKVE
SSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQIS
SMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQIKG
TRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKGPLE
TKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKALNECGLSDPLTGE
SVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDKKVVEDKE
YLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVGRVK
MSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTG
YIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDF
DADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQL
AKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMRSDVGEY
RLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTK
AHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQYVIE
KKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIKVGN
DVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVLGKPSSP
LGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYKFRVRAVNKEGESD
PLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQKTATVPNLK
EGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGIGES
KAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEP
IEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEPTDW
DSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAV
IAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGT
FTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTASGRWVPAAKVAGD
KTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPIEEY
VVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIKVKA
GQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHP
SSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVNRHG
DSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAGELTATV
DGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSP
LSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPL
DDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDV
TPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPGKPSD
PTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTPTSSAIHIFSAVRG
DTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQEVGT
FPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVT
GYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIKIKA
GFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQDRP
SAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTF
GRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQGTAF
SDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKE
GGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDG
GAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEI
TGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSN
GSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKNLGE
KEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFEN
ERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGD
AITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVET
SEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVNSVP
ITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFLATLTIEKSELTDG
GLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSF
VRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPRDGGSKIIG
YQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIG
RNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPI
KIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKFTIKEVWDIDAGEY
TVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDDHIL
ITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLS
KDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQR
PLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGP
KIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATNSSGT
RSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRISNASR
EDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAK
SRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVFDIWK
QYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLVNLHD
AFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELKLIDF
GLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDDSAFS
GISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEPLPPLGRISNYSSL
RKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGNDYGLT
INRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFFTFHLRNRLIQKNH
QCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVSECVLTVQTKGGEP
IPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLSDSETEVGGSAEFS
AAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRATLTVKGDQPLLNGH
AGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTINSADASDAGHYQL
EVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKNERVKSVKTGNTFK
LDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
Estimated Isoelectric Point:
5.57988739013672
Estimated Molecular Weight:
710.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr449
Lys541
Gln153
Leu351
Gly516
Met62
Ser379
Tyr172
His108
Glu505
Arg325
Cys62
Phe177
Pro469
Val506
Asn292
Ala434
Ile336
Trp111
Asp487