Sequence:
download
CE44656sequence.fasta
>RAD-54.B, isoform b MPPMTPGNSENVENRKRGGFSSPFLGIELPKPLSKRSATFVPPLIGSESSSSGGSSSSTIQEKIPPFILNEQDILDRKTT SAVTVDTRFARHLRPHQKSGIQFIFDRLRRGSGKNGGGGGAILADDMGLGKSLQTMAATWALLKGSKTAQQLANSCLIIV PSSLVNNWKAEFDKWWRLMRFPAVIALTANDITTYQSTIKLMPYLVISYDLAQRHVEKLKIIRFDVMVCDEGHKLKNLDG KLRKTLLSLEIPRRLILTGTPMQNDFEEFYSLLDFVRPSVFGSIVEFRKMCSDRPEQLNELIDECMLRRTAADVDLKHLP EKHEYILFCAASPIQKHVHSEICDYMTGDALSLIFFARQLANHPKLLLDNLREKTEKSKAHKHSPLLLAFDGAHMPRGGV KESGKLTALVDMIKCFRLLQECTVIVSNYIETLDMIQQLCEYLNFKVLRLDGKTQVPDRQKLVRTFNDHRDPSNIFLLST KAGGVGLNLIGASRLVLFDSDWNPANDQQAMARIWRDGQVRPCHIYRLITTGTIEEKMLQRQIKKTGLGCVIDAIEVGDT IATFTDEDLKDIFTFTGSATECNTHDLCECPCDGCGMLENEMDEEDDGDDVVENDAEKIDKSGKIDKIDSDDDEEADDEE LEADVTDEVVEDSQEPPEATKPAVAAAGLRTIASLAELSRWRHFSPRHADTWHHFMTNAGLSQVDTDVELTFAFYQESQY
view sequence (720 aa)
>RAD-54.B, isoform b
MPPMTPGNSENVENRKRGGFSSPFLGIELPKPLSKRSATFVPPLIGSESSSSGGSSSSTIQEKIPPFILNEQDILDRKTT
SAVTVDTRFARHLRPHQKSGIQFIFDRLRRGSGKNGGGGGAILADDMGLGKSLQTMAATWALLKGSKTAQQLANSCLIIV
PSSLVNNWKAEFDKWWRLMRFPAVIALTANDITTYQSTIKLMPYLVISYDLAQRHVEKLKIIRFDVMVCDEGHKLKNLDG
KLRKTLLSLEIPRRLILTGTPMQNDFEEFYSLLDFVRPSVFGSIVEFRKMCSDRPEQLNELIDECMLRRTAADVDLKHLP
EKHEYILFCAASPIQKHVHSEICDYMTGDALSLIFFARQLANHPKLLLDNLREKTEKSKAHKHSPLLLAFDGAHMPRGGV
KESGKLTALVDMIKCFRLLQECTVIVSNYIETLDMIQQLCEYLNFKVLRLDGKTQVPDRQKLVRTFNDHRDPSNIFLLST
KAGGVGLNLIGASRLVLFDSDWNPANDQQAMARIWRDGQVRPCHIYRLITTGTIEEKMLQRQIKKTGLGCVIDAIEVGDT
IATFTDEDLKDIFTFTGSATECNTHDLCECPCDGCGMLENEMDEEDDGDDVVENDAEKIDKSGKIDKIDSDDDEEADDEE
LEADVTDEVVEDSQEPPEATKPAVAAAGLRTIASLAELSRWRHFSPRHADTWHHFMTNAGLSQVDTDVELTFAFYQESQY
Estimated Isoelectric Point:
5.33667755126953
Estimated Molecular Weight:
80.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr44
Lys44
Gln27
Leu76
Gly44
Met19
Ser49
Tyr11
His19
Glu49
Arg40
Cys16
Phe31
Pro32
Val36
Asn25
Ala47
Ile44
Trp8
Asp59