Sequence:
download
CE44340sequence.fasta
>TBX-37 MYSCTSPSGIEVSLNKPEIWEKFYPKTEMIVTRKRGRVIFPHLDYNVKGLDPDSLYSIYIHLERVDGIKYKFDAGEWKEA GKGDPILPIQYKEHPRGKRTGTEWMSEPVSFAHLKITNDPENKDQKLILAQSLHKYIPVLHIKQLDPYKGTFQMDFHGVE FRLEATQFIVVTAYQNEELTKLKVHHNKFASGFRSNGKRRLSSESENSENSPPKRSASAISSLTPPAISPPMDYTQQNPY FFNQNFFSTPQSHQPQFAAHSANAQNYNNFGAQNGAQFDWNVYYQRQWYWQQQMMMSGGIGQPQMLNNGFPNL
view sequence (313 aa)
>TBX-37
MYSCTSPSGIEVSLNKPEIWEKFYPKTEMIVTRKRGRVIFPHLDYNVKGLDPDSLYSIYIHLERVDGIKYKFDAGEWKEA
GKGDPILPIQYKEHPRGKRTGTEWMSEPVSFAHLKITNDPENKDQKLILAQSLHKYIPVLHIKQLDPYKGTFQMDFHGVE
FRLEATQFIVVTAYQNEELTKLKVHHNKFASGFRSNGKRRLSSESENSENSPPKRSASAISSLTPPAISPPMDYTQQNPY
FFNQNFFSTPQSHQPQFAAHSANAQNYNNFGAQNGAQFDWNVYYQRQWYWQQQMMMSGGIGQPQMLNNGFPNL
Estimated Isoelectric Point:
8.86540985107422
Estimated Molecular Weight:
36.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys22
Gln23
Leu19
Gly19
Met9
Ser25
Tyr16
His11
Glu18
Arg12
Cys1
Phe18
Pro23
Val12
Asn21
Ala16
Ile17
Trp6
Asp12