Sequence:
download
CE43866sequence.fasta
>UNC-13, isoform f MDDVGDYNDDQLSDGMSMRLLCITIKKARLQGAVDEFNSYVTVKLQTVKSTTVAVRGNLPCWEQEFIFETNRPDDGMVLE LWAKGVLWDKLIGVHYMPLSEIRYSNAAGSGQWLQMDHELETRNGQTVGTRGPTGHNLLTDVRFELPFDVQGHDEDIQSR LLALNGLIEHDQLGPNNHHRAPFNHSGLSEDSDYTSDVSVPVNHHQLHPNSSAHQYESHLHPHRTRQLLHTREGATLQAS YEDEEDAYHARHQPESDDYNHQDTYDQHSSYYNDEYAPSGSSSQYQRQGYQDQDQQHQNIYEDTVTPVREFGESAVPPAA SSSRRQFDQVYGYASSSEERYDTPMSSGRLPRDEPILEHSEPEYVYDQNGYPEEDNYGINPTYSEDHFEGQTNDYSTTHQ EPNDFRNDYNSSYQREYWNESEPLSYNSRPPNGHIRTGANTWREPSTSSRPTSSQAWNYQDDTHQYDEVDRGSRVSFTRT PSVDRTDRPSESGGGFYDEMSESGRPGRPDSHHNWRYDSIQEEDNEKDNWKQHVEGYEEGQEEKQKDNQKPNDHSAASPQ DHYHRSDSTAQQDFGNNIVRQTIQEEEEKRNYQELWHNAYKRVCADLGIKSTVLDGNGSSAANAFYKSIDAAPNMNVART KTSIPLVSELVLKTMATKRAQAGLANAARTTFSDTELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLW GLARQGLRCTQCQVKVHDKCRELLSADCLQRAAEKSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENI QKETLKTVKASILEGSSKWSAKITLTVLCAQGLIAKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNST DRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPY HVQYTCLHEHLFAAHCVDEEVKLPKVRGEDSWKVCFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLS TLLANINAYYAHTTATSAVSAPDRFAASNFGKERFVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITF FRMKVLELASPPRASTVVRECAKACMQQTYQLMFESCAEQFPILDTSVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQEL NVGNLSAETLWSMYKNDLKMALEEHAQKKRCKTPEYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNEND EHSMDILRNAYNVDKADNFPQTSEHTKFSNSVVDVFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQ KDFPKFAHDEKLACILMNNVQQLRVQLEKIYETMGGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKL GMLLVKIKGPQLQKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLSDKALLKQ LPNAKIGDVTKLMSTNIQSIKGMNSVKDMMDMARESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSL KYALSLYTQTTEQLIKTFITSQRQQDLPSQEQPVGEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHL VGPHLSDKKRKWSTKTKAGNWAPKFNETFHFFLGNEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMW VQLGTRLHIDETGLILLRILSQRQTDEVAKDFVRLKTECRYETETVMAASASSQNINRT
view sequence (1819 aa)
>UNC-13, isoform f
MDDVGDYNDDQLSDGMSMRLLCITIKKARLQGAVDEFNSYVTVKLQTVKSTTVAVRGNLPCWEQEFIFETNRPDDGMVLE
LWAKGVLWDKLIGVHYMPLSEIRYSNAAGSGQWLQMDHELETRNGQTVGTRGPTGHNLLTDVRFELPFDVQGHDEDIQSR
LLALNGLIEHDQLGPNNHHRAPFNHSGLSEDSDYTSDVSVPVNHHQLHPNSSAHQYESHLHPHRTRQLLHTREGATLQAS
YEDEEDAYHARHQPESDDYNHQDTYDQHSSYYNDEYAPSGSSSQYQRQGYQDQDQQHQNIYEDTVTPVREFGESAVPPAA
SSSRRQFDQVYGYASSSEERYDTPMSSGRLPRDEPILEHSEPEYVYDQNGYPEEDNYGINPTYSEDHFEGQTNDYSTTHQ
EPNDFRNDYNSSYQREYWNESEPLSYNSRPPNGHIRTGANTWREPSTSSRPTSSQAWNYQDDTHQYDEVDRGSRVSFTRT
PSVDRTDRPSESGGGFYDEMSESGRPGRPDSHHNWRYDSIQEEDNEKDNWKQHVEGYEEGQEEKQKDNQKPNDHSAASPQ
DHYHRSDSTAQQDFGNNIVRQTIQEEEEKRNYQELWHNAYKRVCADLGIKSTVLDGNGSSAANAFYKSIDAAPNMNVART
KTSIPLVSELVLKTMATKRAQAGLANAARTTFSDTELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLW
GLARQGLRCTQCQVKVHDKCRELLSADCLQRAAEKSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENI
QKETLKTVKASILEGSSKWSAKITLTVLCAQGLIAKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNST
DRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPY
HVQYTCLHEHLFAAHCVDEEVKLPKVRGEDSWKVCFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLS
TLLANINAYYAHTTATSAVSAPDRFAASNFGKERFVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITF
FRMKVLELASPPRASTVVRECAKACMQQTYQLMFESCAEQFPILDTSVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQEL
NVGNLSAETLWSMYKNDLKMALEEHAQKKRCKTPEYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNEND
EHSMDILRNAYNVDKADNFPQTSEHTKFSNSVVDVFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQ
KDFPKFAHDEKLACILMNNVQQLRVQLEKIYETMGGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKL
GMLLVKIKGPQLQKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLSDKALLKQ
LPNAKIGDVTKLMSTNIQSIKGMNSVKDMMDMARESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSL
KYALSLYTQTTEQLIKTFITSQRQQDLPSQEQPVGEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHL
VGPHLSDKKRKWSTKTKAGNWAPKFNETFHFFLGNEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMW
VQLGTRLHIDETGLILLRILSQRQTDEVAKDFVRLKTECRYETETVMAASASSQNINRT
Estimated Isoelectric Point:
5.68498992919922
Estimated Molecular Weight:
207.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr120
Lys113
Gln113
Leu154
Gly82
Met42
Ser138
Tyr71
His63
Glu137
Arg92
Cys29
Phe65
Pro76
Val113
Asn85
Ala116
Ile65
Trp25
Asp120