Sequence:
download
CE43607sequence.fasta
>LEV-10, isoform e MHLIYLFLLSIFVSKADGNSRKTIFQCDQHFDESQPEGVIEFPSLPKQLALSHGVNNSKPEQQYNLQCVYTFVAGSRQRV RLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHVRISLRRVMKLVLHSRSTNHEDNHGFRAKY SFIPEDKFIAGEPVGGKKCSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAGRGERIRLFFTDFDIFFGGEHCPYDS VTIFDGPTPASPIIRKVCGLQQRMEVYSMGNSLLIHFNTTHPAKSDPRGFIMDYEFSTRFVNIDKLLNKQRGVTHIRGTE CDVRVESNRETFHTISSPNSIQPTPPAPTSFMDFRESRTWRRLYLPLIL
view sequence (369 aa)
>LEV-10, isoform e
MHLIYLFLLSIFVSKADGNSRKTIFQCDQHFDESQPEGVIEFPSLPKQLALSHGVNNSKPEQQYNLQCVYTFVAGSRQRV
RLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHVRISLRRVMKLVLHSRSTNHEDNHGFRAKY
SFIPEDKFIAGEPVGGKKCSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAGRGERIRLFFTDFDIFFGGEHCPYDS
VTIFDGPTPASPIIRKVCGLQQRMEVYSMGNSLLIHFNTTHPAKSDPRGFIMDYEFSTRFVNIDKLLNKQRGVTHIRGTE
CDVRVESNRETFHTISSPNSIQPTPPAPTSFMDFRESRTWRRLYLPLIL
Estimated Isoelectric Point:
6.94194793701172
Estimated Molecular Weight:
42.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr20
Lys15
Gln12
Leu28
Gly24
Met8
Ser36
Tyr15
His15
Glu21
Arg26
Cys9
Phe25
Pro22
Val21
Asn14
Ala11
Ile25
Trp1
Asp21