Sequence:
download
CE43589sequence.fasta
>LIN-7, isoform a MDNPDGPNLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVYESIDADTTPEIKAAATAKATVAA FAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLIAVNGVNVEAECHEKAVDLLK SAVGSVKLVIRYMPKLLDEMERRFERQRIRSTQQSPTLPTPSSSTNPRR
view sequence (209 aa)
>LIN-7, isoform a
MDNPDGPNLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVYESIDADTTPEIKAAATAKATVAA
FAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLIAVNGVNVEAECHEKAVDLLK
SAVGSVKLVIRYMPKLLDEMERRFERQRIRSTQQSPTLPTPSSSTNPRR
Estimated Isoelectric Point:
6.23314666748047
Estimated Molecular Weight:
22.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys11
Gln11
Leu16
Gly15
Met5
Ser12
Tyr4
His5
Glu18
Arg15
Cys1
Phe5
Pro12
Val18
Asn9
Ala20
Ile11
Asp10