Sequence:
download
CE43583sequence.fasta
>SCL-18 MHCIKLYSPVITRGFLLLFLTIVQLHKGVESIFSRKGQQDVLDHHNNIRSQLAFGNFVTKRHTKRAAGSNIKKFVWNATL ERSAYSFAQKNPSQHSFIPDIGENLFWHWSTRPGDFNKYGPMAALSWIKEFREKFWDSNILTNDLFGSGVGHATQMVWAD TYQMGCAVSHFKEIHKRTGRPITKICVVCHYWPKGNYLNEPIYLEGPPCSKCESKKCDKRTGLCI
view sequence (225 aa)
>SCL-18
MHCIKLYSPVITRGFLLLFLTIVQLHKGVESIFSRKGQQDVLDHHNNIRSQLAFGNFVTKRHTKRAAGSNIKKFVWNATL
ERSAYSFAQKNPSQHSFIPDIGENLFWHWSTRPGDFNKYGPMAALSWIKEFREKFWDSNILTNDLFGSGVGHATQMVWAD
TYQMGCAVSHFKEIHKRTGRPITKICVVCHYWPKGNYLNEPIYLEGPPCSKCESKKCDKRTGLCI
Estimated Isoelectric Point:
9.47530364990234
Estimated Molecular Weight:
25.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys19
Gln8
Leu16
Gly16
Met4
Ser16
Tyr7
His11
Glu9
Arg11
Cys8
Phe14
Pro10
Val11
Asn12
Ala11
Ile15
Trp7
Asp8