Sequence:
download
CE43448sequence.fasta
>C49C3.11 MRFLYISAVALVISVAAIGNPFGGDDKCEEGKPTCPPGYKFQEREGKRGWCLKYFPGNTTFEEAEKICRCQGGASLSGIE NMKELTWVIVQAKASFAEEGIQTGGIWVGAYRRKACWDKKNLNKTECSKELQYQWTDRNTVGNLMWKKRWTAGAPHDNTV GDHHEYCVQLQVTVDPALANKNLTGFFDNRVCVNPAAENQFPSEGFLCGRPPKYTGGGNGGYGGGGGLVIIGAGKPTKKP
view sequence (240 aa)
>C49C3.11
MRFLYISAVALVISVAAIGNPFGGDDKCEEGKPTCPPGYKFQEREGKRGWCLKYFPGNTTFEEAEKICRCQGGASLSGIE
NMKELTWVIVQAKASFAEEGIQTGGIWVGAYRRKACWDKKNLNKTECSKELQYQWTDRNTVGNLMWKKRWTAGAPHDNTV
GDHHEYCVQLQVTVDPALANKNLTGFFDNRVCVNPAAENQFPSEGFLCGRPPKYTGGGNGGYGGGGGLVIIGAGKPTKKP
Estimated Isoelectric Point:
8.74161529541016
Estimated Molecular Weight:
26.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys20
Gln9
Leu13
Gly33
Met3
Ser7
Tyr8
His3
Glu16
Arg10
Cys10
Phe10
Pro13
Val14
Asn14
Ala18
Ile10
Trp7
Asp8