Sequence:
download
CE42905sequence.fasta
>PLC-3 MQHGSLGPSSSSRKTTVTSTAGSVHLHHRSSNGFSTASRAQLNRHNEMDFGKMFAAMEKGHKVCKIAVLKKWDPAYKQLT LDRYSRQIFLTKLELSAVRNKPTILDIRQIREVQTLNYKLNTIKVDDKWKKDREIVNFDSKAILIISYGMGFALSYWILL FESEDACKLWSQGLHNLMMDTRDRDSSPHPLRIERFLHKHFLSLMSPANDAVARKHMKPFVQTSLQFKVQSDQLQQVTED QMNSDQFSFASRQLIHVPELFSSRFADLAEKHERKGLVVTFQNFLRFLDGKQFDELASNRTRALEFLNRYFQEDQAYFGD RNEPSMTVFEFCDFLFSRENSLWDPTNEKVTHDMSRPLSHYWIASSHNTYLTGDQLRSESSLDCYAQALLMGCRCIELDC WDGQKKPGSAEFIDIVIYHGYTMTSKILLRDVLHVIRHYAFVTSEYPVILSIEDNCSVPAQRLLAQELKDILGDYLLTQP ANREEKQLPSPAALKKKIIVKHKKLPIESEDLAAVVKTDEFQDTEIISRECVKKGILMVKNNNSHEWTSHVFILFPDRLC YLIQTADPENPNDDTVSVSGDEEREEETPSGFGVKPEEMHVTEEWFHGRCERDEAKKRILEHKEKGNGLFMIRDSNLFIG DFSLSILHDGKVHHVRIRSKIIDKEKKYYFMDNKVCDTLYELVSYYTRHYLTTAHFKMVLTIPCPQPQPHLNQPWFSATA DKEKAEELLSLVPEDGAFLIRTSSTDSSVYVLSLKVDGEFWHYRLKRDGRIFVVNQKVFENLNQIVEFYANREFVRGISL RFPVNEKDISHLTAELAEARTPGCYMDLKDLDKEVQARALRPYRGTADDELSFPANVIITVLRKEEGLWRGRYGSLTGWF PSAHVQEILPEKVSTSETSNYNTIELAGTLIERIHDADRPNVIRISQSNQHWMNKQYYLLAASSSEEADGWQNNLFELTR SVNTKMSILRTKEKEKRIAAELSNLVVYCQAVPFDPAHIYNDAFYEMCSFVEGKLDKLVEKGLLPFNSRKLSRVYPNGSR ITSNNYSPVPMWNAGCHMVALNYQTGDKPMQLNQGKFLANGRCGYLLKPDYMLTDDFDPTNTEKFATAYPIRLNVQVIGG RHLSRKDKNKGICSPFVEIEIIGMPCDTKVFQTKTIASNGLNPIWNQTFTFEIQCPEVALIRFHVEDGDFVGPKTDPFIG QAVFPVDSIRCGFRSVPLKNQYSEELELSSLLVDVQMCSREGTQLIRSSSHFLQASRLAPVFAHRKITNGDSIPREMAPR LRTSATDRSLDSPTNSESRATLLSGQRGSQDSMDSAAETSSIASGTISSRDGKKKQNWLKKFSFGKSSKS
view sequence (1350 aa)
>PLC-3
MQHGSLGPSSSSRKTTVTSTAGSVHLHHRSSNGFSTASRAQLNRHNEMDFGKMFAAMEKGHKVCKIAVLKKWDPAYKQLT
LDRYSRQIFLTKLELSAVRNKPTILDIRQIREVQTLNYKLNTIKVDDKWKKDREIVNFDSKAILIISYGMGFALSYWILL
FESEDACKLWSQGLHNLMMDTRDRDSSPHPLRIERFLHKHFLSLMSPANDAVARKHMKPFVQTSLQFKVQSDQLQQVTED
QMNSDQFSFASRQLIHVPELFSSRFADLAEKHERKGLVVTFQNFLRFLDGKQFDELASNRTRALEFLNRYFQEDQAYFGD
RNEPSMTVFEFCDFLFSRENSLWDPTNEKVTHDMSRPLSHYWIASSHNTYLTGDQLRSESSLDCYAQALLMGCRCIELDC
WDGQKKPGSAEFIDIVIYHGYTMTSKILLRDVLHVIRHYAFVTSEYPVILSIEDNCSVPAQRLLAQELKDILGDYLLTQP
ANREEKQLPSPAALKKKIIVKHKKLPIESEDLAAVVKTDEFQDTEIISRECVKKGILMVKNNNSHEWTSHVFILFPDRLC
YLIQTADPENPNDDTVSVSGDEEREEETPSGFGVKPEEMHVTEEWFHGRCERDEAKKRILEHKEKGNGLFMIRDSNLFIG
DFSLSILHDGKVHHVRIRSKIIDKEKKYYFMDNKVCDTLYELVSYYTRHYLTTAHFKMVLTIPCPQPQPHLNQPWFSATA
DKEKAEELLSLVPEDGAFLIRTSSTDSSVYVLSLKVDGEFWHYRLKRDGRIFVVNQKVFENLNQIVEFYANREFVRGISL
RFPVNEKDISHLTAELAEARTPGCYMDLKDLDKEVQARALRPYRGTADDELSFPANVIITVLRKEEGLWRGRYGSLTGWF
PSAHVQEILPEKVSTSETSNYNTIELAGTLIERIHDADRPNVIRISQSNQHWMNKQYYLLAASSSEEADGWQNNLFELTR
SVNTKMSILRTKEKEKRIAAELSNLVVYCQAVPFDPAHIYNDAFYEMCSFVEGKLDKLVEKGLLPFNSRKLSRVYPNGSR
ITSNNYSPVPMWNAGCHMVALNYQTGDKPMQLNQGKFLANGRCGYLLKPDYMLTDDFDPTNTEKFATAYPIRLNVQVIGG
RHLSRKDKNKGICSPFVEIEIIGMPCDTKVFQTKTIASNGLNPIWNQTFTFEIQCPEVALIRFHVEDGDFVGPKTDPFIG
QAVFPVDSIRCGFRSVPLKNQYSEELELSSLLVDVQMCSREGTQLIRSSSHFLQASRLAPVFAHRKITNGDSIPREMAPR
LRTSATDRSLDSPTNSESRATLLSGQRGSQDSMDSAAETSSIASGTISSRDGKKKQNWLKKFSFGKSSKS
Estimated Isoelectric Point:
7.12726593017578
Estimated Molecular Weight:
154.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr71
Lys90
Gln56
Leu127
Gly63
Met31
Ser119
Tyr41
His42
Glu91
Arg82
Cys23
Phe69
Pro58
Val76
Asn62
Ala75
Ile73
Trp18
Asp83