Sequence:
download
CE42801sequence.fasta
>SUP-12, isoform b MYGQVQDPLVHAAAAALAQSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGF VTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQVQLPLTTQLQALFQPRMGQVAG
view sequence (151 aa)
>SUP-12, isoform b
MYGQVQDPLVHAAAAALAQSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGF
VTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQVQLPLTTQLQALFQPRMGQVAG
Estimated Isoelectric Point:
7.87387847900391
Estimated Molecular Weight:
16.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys7
Gln12
Leu12
Gly12
Met4
Ser5
Tyr5
His3
Glu6
Arg8
Cys1
Phe6
Pro8
Val12
Asn6
Ala20
Ile5
Asp8