Sequence:
download
CE42124sequence.fasta
>RGS-7, isoform g MLSVTYPMIAKTNSQILTKFHHTETHQSTPNLHHHHHHHNISGPISRTLSYLRSKMDLALSTSSLYPSRDDVRQWEISFE SLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKKMKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAATKAAVEA GCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDLLESYEITDKEDKPSSSKDKN
view sequence (215 aa)
>RGS-7, isoform g
MLSVTYPMIAKTNSQILTKFHHTETHQSTPNLHHHHHHHNISGPISRTLSYLRSKMDLALSTSSLYPSRDDVRQWEISFE
SLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKKMKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAATKAAVEA
GCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDLLESYEITDKEDKPSSSKDKN
Estimated Isoelectric Point:
6.83449554443359
Estimated Molecular Weight:
25.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys20
Gln7
Leu21
Gly4
Met6
Ser25
Tyr6
His11
Glu17
Arg11
Cys3
Phe12
Pro7
Val6
Asn8
Ala12
Ile8
Trp2
Asp15